BLASTX nr result
ID: Phellodendron21_contig00039016
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00039016 (395 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006442602.1 hypothetical protein CICLE_v10021711mg [Citrus cl... 54 4e-06 >XP_006442602.1 hypothetical protein CICLE_v10021711mg [Citrus clementina] ESR55842.1 hypothetical protein CICLE_v10021711mg [Citrus clementina] Length = 266 Score = 54.3 bits (129), Expect = 4e-06 Identities = 44/123 (35%), Positives = 54/123 (43%), Gaps = 27/123 (21%) Frame = +2 Query: 62 LITMSFSTSVNSKER*RCHKCPNNY*KLWISSALRNLN*KF*KCKDCLSFDWDDEDQW-- 235 +I STS N + C KC N+ L IS N N KF KCK C +F+WD D W Sbjct: 128 IIMSCSSTSENRTQVKACEKCSNSNKVLRISRTRENPNCKFWKCKGCGAFEWD--DNWKS 185 Query: 236 --------VRD*KSNELNYAVLLGEIR-------------QLISDELRNR----ELNFI* 340 + D NE +LLGE+R QL ELR R +L+ I Sbjct: 186 SECNDFGGMEDRSMNENKIDILLGEVRSLGHQMECLSLKFQLFEKELRQRQPHEDLSLIV 245 Query: 341 KYV 349 KYV Sbjct: 246 KYV 248