BLASTX nr result
ID: Phellodendron21_contig00038871
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038871 (385 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007416503.1 hypothetical protein MELLADRAFT_73209 [Melampsora... 68 1e-10 >XP_007416503.1 hypothetical protein MELLADRAFT_73209 [Melampsora larici-populina 98AG31] EGG00304.1 hypothetical protein MELLADRAFT_73209 [Melampsora larici-populina 98AG31] Length = 476 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -1 Query: 385 MYDYEGWAIVSIDQLAEVGKLGSALVAAGLLWPRDEDGRKDIWIKLK 245 ++ YEGW I+ I EVG LG AL AGL WP DE+GRKDIW+KLK Sbjct: 411 VHGYEGWGIIPIKHTVEVGNLGRALCRAGLAWPSDENGRKDIWLKLK 457