BLASTX nr result
ID: Phellodendron21_contig00038653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038653 (372 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF26587.1 conserved hypothetical protein [Ricinus communis] 98 9e-25 KJB09782.1 hypothetical protein B456_001G165500 [Gossypium raimo... 64 2e-19 >EEF26587.1 conserved hypothetical protein [Ricinus communis] Length = 51 Score = 97.8 bits (242), Expect = 9e-25 Identities = 48/52 (92%), Positives = 49/52 (94%) Frame = -2 Query: 263 MGLPKENYNRSLSTTHKTTEIFDLAPEGNGNPPCPSPTYTRGAEDNERETKS 108 MGLPKEN NRSLSTTHKTTEIFDLAP+GN NPP PSPTYTRGAEDNERETKS Sbjct: 1 MGLPKENCNRSLSTTHKTTEIFDLAPKGN-NPPGPSPTYTRGAEDNERETKS 51 >KJB09782.1 hypothetical protein B456_001G165500 [Gossypium raimondii] Length = 732 Score = 63.9 bits (154), Expect(2) = 2e-19 Identities = 34/50 (68%), Positives = 34/50 (68%), Gaps = 6/50 (12%) Frame = +2 Query: 44 TNRIDSTDMIDGMGSL------CYDLVRTLSPFXXXXXXXXXXGKGRVDY 175 TNRIDSTDMIDGMGSL CYDLVRTLSPF GKGRVDY Sbjct: 361 TNRIDSTDMIDGMGSLCYDVDVCYDLVRTLSPFRYLPLPLYRLGKGRVDY 410 Score = 58.9 bits (141), Expect(2) = 2e-19 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 282 TKKTVDISTSWVEGDDPNESTMKVAASYIS 371 TKKTVD STSWVEGDDPNESTMKVA SYI+ Sbjct: 421 TKKTVDTSTSWVEGDDPNESTMKVAVSYIN 450