BLASTX nr result
ID: Phellodendron21_contig00038595
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038595 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006439759.1 hypothetical protein CICLE_v10018474mg [Citrus cl... 60 8e-09 >XP_006439759.1 hypothetical protein CICLE_v10018474mg [Citrus clementina] XP_006439760.1 hypothetical protein CICLE_v10018474mg [Citrus clementina] ESR52999.1 hypothetical protein CICLE_v10018474mg [Citrus clementina] ESR53000.1 hypothetical protein CICLE_v10018474mg [Citrus clementina] Length = 1634 Score = 60.5 bits (145), Expect = 8e-09 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 227 MCMHGWRAGEAERKRAGQRTWTILTRANVTGD 132 MCMHGWRAGEAERKRAG+ WT+ TRA+V GD Sbjct: 1 MCMHGWRAGEAERKRAGRHMWTVPTRASVAGD 32