BLASTX nr result
ID: Phellodendron21_contig00038580
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038580 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007413635.1 hypothetical protein MELLADRAFT_90401 [Melampsora... 68 2e-11 >XP_007413635.1 hypothetical protein MELLADRAFT_90401 [Melampsora larici-populina 98AG31] EGG03175.1 hypothetical protein MELLADRAFT_90401 [Melampsora larici-populina 98AG31] Length = 478 Score = 68.2 bits (165), Expect = 2e-11 Identities = 36/87 (41%), Positives = 53/87 (60%), Gaps = 5/87 (5%) Frame = -3 Query: 248 SEDALVESDLVLPIDWSLLVNLAQTCRSLYKLCSPYYLRRLTISARPRSRPSQLHSEPPD 69 S++ +E + PI+WS L+NLA TC SL+ LC P+YLRRL IS+ P + S+ D Sbjct: 41 SDEDEIEEEGPKPINWSTLINLALTCHSLHDLCCPFYLRRLVISSGPSRLGFSVPSDRDD 100 Query: 68 LFTLCNIHANN-----PALPHVTTLYY 3 + +L +I N+ L HVTT++Y Sbjct: 101 IRSLLDITQNHLLLRASTLRHVTTIFY 127