BLASTX nr result
ID: Phellodendron21_contig00038294
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038294 (445 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006449214.1 hypothetical protein CICLE_v10015313mg [Citrus cl... 54 9e-06 >XP_006449214.1 hypothetical protein CICLE_v10015313mg [Citrus clementina] XP_006467896.1 PREDICTED: telomerase Cajal body protein 1 [Citrus sinensis] ESR62454.1 hypothetical protein CICLE_v10015313mg [Citrus clementina] KDO75718.1 hypothetical protein CISIN_1g014125mg [Citrus sinensis] Length = 430 Score = 54.3 bits (129), Expect = 9e-06 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -2 Query: 384 VWSFSYVSTMENADGIKRGEFNIQSEHENLN*DS 283 VWSF Y S MENADGI EFN QSEHENLN DS Sbjct: 397 VWSFLYASMMENADGINGCEFNCQSEHENLNQDS 430