BLASTX nr result
ID: Phellodendron21_contig00038259
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038259 (416 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007412659.1 hypothetical protein MELLADRAFT_78393 [Melampsora... 89 1e-18 KNF05780.1 hypothetical protein PSTG_01177 [Puccinia striiformis... 74 7e-13 KNZ50934.1 uncharacterized protein VP01_416g9 [Puccinia sorghi] 70 6e-12 OAV92111.1 hypothetical protein PTTG_07875 [Puccinia triticina 1... 68 9e-11 >XP_007412659.1 hypothetical protein MELLADRAFT_78393 [Melampsora larici-populina 98AG31] EGG04198.1 hypothetical protein MELLADRAFT_78393 [Melampsora larici-populina 98AG31] Length = 287 Score = 89.0 bits (219), Expect = 1e-18 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = -3 Query: 183 MSPANCLAPSGPPPAVSLDLWTETSDRKTRSALRAISDDVLSRANLAIKVNIPGKILELT 4 MSP S PPPA+S DLWTETSD+KTR ALRA+SDDVL+RA+LAIKV++P KILELT Sbjct: 1 MSPTITFDKSAPPPAISGDLWTETSDKKTRVALRAVSDDVLARASLAIKVSLPRKILELT 60 Query: 3 D 1 D Sbjct: 61 D 61 >KNF05780.1 hypothetical protein PSTG_01177 [Puccinia striiformis f. sp. tritici PST-78] Length = 440 Score = 74.3 bits (181), Expect = 7e-13 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -3 Query: 150 PPPAVSLDLWTETSDRKTRSALRAISDDVLSRANLAIKVNIPGKILELTD 1 PPPAVS DLW ET+D K R ALRA+SDDVL+R +L+I++ +P KILELTD Sbjct: 152 PPPAVSQDLWVETTDGKARKALRAVSDDVLARGSLSIQIGLPRKILELTD 201 >KNZ50934.1 uncharacterized protein VP01_416g9 [Puccinia sorghi] Length = 253 Score = 70.5 bits (171), Expect = 6e-12 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = -3 Query: 150 PPPAVSLDLWTETSDRKTRSALRAISDDVLSRANLAIKVNIPGKILELTD 1 PPPAVS DLW ET+D KTR ALRA+SD VL+R +LAI+V +P +ILEL++ Sbjct: 18 PPPAVSQDLWLETTDGKTRKALRAVSDGVLARGSLAIQVGLPRRILELSE 67 >OAV92111.1 hypothetical protein PTTG_07875 [Puccinia triticina 1-1 BBBD Race 1] Length = 372 Score = 68.2 bits (165), Expect = 9e-11 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = -3 Query: 150 PPPAVSLDLWTETSDRKTRSALRAISDDVLSRANLAIKVNIPGKILELTD 1 P PAVS DLW ET D K+R ALR +SDDVL+R +LAI++ +P +ILELTD Sbjct: 17 PSPAVSQDLWAETIDDKSRKALRVVSDDVLARGSLAIQLGLPRRILELTD 66