BLASTX nr result
ID: Phellodendron21_contig00038213
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038213 (337 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EID19495.1 hypothetical protein HMPREF1043_0707 [Streptococcus a... 87 4e-19 CNJ48920.1 Uncharacterised protein [Mycobacterium tuberculosis] 62 2e-09 >EID19495.1 hypothetical protein HMPREF1043_0707 [Streptococcus anginosus subsp. whileyi CCUG 39159] Length = 191 Score = 87.0 bits (214), Expect = 4e-19 Identities = 47/79 (59%), Positives = 53/79 (67%), Gaps = 1/79 (1%) Frame = -3 Query: 335 LTT*VGFGYGRLQPRVDAFLGSIGSL-ISPYGYASDLRHTDDGFAYRQPYILTPGSPYGY 159 LTT VG GYG+ +P DAFLGSIGS P G S LRHT GF YRQPY L PG + Sbjct: 55 LTTCVGLGYGQFEPHADAFLGSIGSPDHPPCGRPSGLRHTAGGFTYRQPYTLRPGH---F 111 Query: 158 HRLAQLPSCVTPVHTLTAP 102 H A+LPSCVTPV+ L +P Sbjct: 112 HCPARLPSCVTPVNALASP 130 >CNJ48920.1 Uncharacterised protein [Mycobacterium tuberculosis] Length = 189 Score = 62.0 bits (149), Expect = 2e-09 Identities = 39/81 (48%), Positives = 47/81 (58%), Gaps = 4/81 (4%) Frame = -3 Query: 335 LTT*VGFGYGRLQPRVDAFLGSIGSLISPYGYASDLRHTDDGFAYRQPYILTPGSP---- 168 L T VG GYGRL+P DAFLGSIGS P + + T QP LT +P Sbjct: 55 LITCVGLGYGRLKPHADAFLGSIGSPNPPKTGSHHVSGT-------QPAHLTTDNPTRLD 107 Query: 167 YGYHRLAQLPSCVTPVHTLTA 105 + HR+A LPSCVTPV+T T+ Sbjct: 108 HDNHRVAWLPSCVTPVNTFTS 128