BLASTX nr result
ID: Phellodendron21_contig00038202
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038202 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003857387.1 60S ribosomal protein L16 [Zymoseptoria tritici I... 86 6e-19 KJY01158.1 60s ribosomal protein l16 [Zymoseptoria brevis] 84 5e-18 KXL46394.1 hypothetical protein FE78DRAFT_146253 [Acidomyces ric... 67 1e-11 EME50247.1 hypothetical protein DOTSEDRAFT_68952 [Dothistroma se... 66 4e-11 CZR66251.1 60S ribosomal protein L13 [Phialocephala subalpina] 64 2e-10 KKY29558.1 putative 60s ribosomal protein l16 [Diaporthe ampelina] 64 2e-10 OCW43866.1 60S ribosomal protein L16 [Diaporthe helianthi] 63 3e-10 XP_007672034.1 hypothetical protein BAUCODRAFT_60972 [Baudoinia ... 62 8e-10 XP_007778809.1 60S ribosomal protein L16 [Coniosporium apollinis... 62 2e-09 XP_012742889.1 60S ribosomal protein L16 [Pseudogymnoascus destr... 62 2e-09 XP_001543118.1 60S ribosomal protein L16 [Histoplasma capsulatum... 61 2e-09 XP_003016160.1 hypothetical protein ARB_05557 [Trichophyton benh... 59 3e-09 EDP55936.1 ribosomal protein L16a [Aspergillus fumigatus A1163] ... 61 3e-09 OAA56547.1 60S ribosomal protein l16 [Sporothrix insectorum RCEF... 61 3e-09 EER45034.1 60S ribosomal protein L13a [Histoplasma capsulatum H1... 61 3e-09 XP_002625192.1 60S ribosomal protein L16 [Blastomyces gilchristi... 61 3e-09 EPE08609.1 60s ribosomal protein l16 [Ophiostoma piceae UAMH 11346] 61 4e-09 KUI57339.1 60S ribosomal protein L16 [Valsa mali var. pyri] KUI6... 60 5e-09 GAQ11194.1 60S ribosomal protein L16 [Aspergillus lentulus] 60 5e-09 KOS21940.1 60S ribosomal protein L16 [Escovopsis weberi] 60 5e-09 >XP_003857387.1 60S ribosomal protein L16 [Zymoseptoria tritici IPO323] EGP92363.1 hypothetical protein MYCGRDRAFT_102406 [Zymoseptoria tritici IPO323] Length = 202 Score = 86.3 bits (212), Expect = 6e-19 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVKGQAYYERKSAA KNLVEAKKNAK+PEA QKQLEQYGY Sbjct: 158 LEERRKVKGQAYYERKSAARKNLVEAKKNAKVPEAVQKQLEQYGY 202 >KJY01158.1 60s ribosomal protein l16 [Zymoseptoria brevis] Length = 202 Score = 84.0 bits (206), Expect = 5e-18 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVKGQAYYERKSAA KNLVEAKKNAK+P A QKQLEQYGY Sbjct: 158 LEERRKVKGQAYYERKSAARKNLVEAKKNAKVPAAVQKQLEQYGY 202 >KXL46394.1 hypothetical protein FE78DRAFT_146253 [Acidomyces richmondensis] KYG46184.1 hypothetical protein M433DRAFT_65722 [Acidomyces richmondensis BFW] Length = 202 Score = 67.0 bits (162), Expect = 1e-11 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVKG+AYYERK AA K L +AK NAKI T+KQLEQYGY Sbjct: 158 LEERRKVKGKAYYERKKAARKMLGDAKANAKIDADTKKQLEQYGY 202 >EME50247.1 hypothetical protein DOTSEDRAFT_68952 [Dothistroma septosporum NZE10] Length = 202 Score = 65.9 bits (159), Expect = 4e-11 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVKGQAYYE+K AA K+L EAK+ A IP+ ++QLEQ+GY Sbjct: 158 LEERRKVKGQAYYEKKRAARKSLAEAKEKAAIPDNVKQQLEQFGY 202 >CZR66251.1 60S ribosomal protein L13 [Phialocephala subalpina] Length = 202 Score = 63.9 bits (154), Expect = 2e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVKG AYYERK AA + L EA+K+AK+ + T+KQL +YGY Sbjct: 158 LEERRKVKGAAYYERKKAARRQLSEAQKSAKVDDKTKKQLAEYGY 202 >KKY29558.1 putative 60s ribosomal protein l16 [Diaporthe ampelina] Length = 202 Score = 63.9 bits (154), Expect = 2e-10 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRK KG AYYERK AA + L E KKNAK+ E T K LE YGY Sbjct: 158 LEERRKAKGAAYYERKKAARRQLAEGKKNAKVDEKTVKALEAYGY 202 >OCW43866.1 60S ribosomal protein L16 [Diaporthe helianthi] Length = 153 Score = 62.8 bits (151), Expect = 3e-10 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRK KG AYYERK AA + L E KKNAK+ + T K LE YGY Sbjct: 109 LEERRKAKGAAYYERKKAARRQLAEGKKNAKVDDKTVKALEAYGY 153 >XP_007672034.1 hypothetical protein BAUCODRAFT_60972 [Baudoinia panamericana UAMH 10762] EMD00850.1 hypothetical protein BAUCODRAFT_60972 [Baudoinia panamericana UAMH 10762] Length = 202 Score = 62.4 bits (150), Expect = 8e-10 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVKGQAYYERK AA K L +AK+NA + + T++QLE GY Sbjct: 158 LEERRKVKGQAYYERKKAARKMLADAKQNAGVSDETKQQLESLGY 202 >XP_007778809.1 60S ribosomal protein L16 [Coniosporium apollinis CBS 100218] EON63492.1 60S ribosomal protein L16 [Coniosporium apollinis CBS 100218] Length = 202 Score = 61.6 bits (148), Expect = 2e-09 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVKG AYYERK AA + L EA+K+A + E T+ QL +YGY Sbjct: 158 LEERRKVKGAAYYERKKAARRQLAEAQKSASVDEKTKTQLAEYGY 202 >XP_012742889.1 60S ribosomal protein L16 [Pseudogymnoascus destructans 20631-21] XP_018133451.1 60S ribosomal protein L16 [Pseudogymnoascus verrucosus] ELR10067.1 60S ribosomal protein L16 [Pseudogymnoascus destructans 20631-21] KFY18759.1 hypothetical protein V493_08367 [Pseudogymnoascus sp. VKM F-4281 (FW-2241)] KFY70279.1 hypothetical protein V499_09301 [Pseudogymnoascus sp. VKM F-103] KFY88277.1 hypothetical protein V500_06438 [Pseudogymnoascus sp. VKM F-4518 (FW-2643)] KFZ08930.1 hypothetical protein V501_05774 [Pseudogymnoascus sp. VKM F-4519 (FW-2642)] KFZ22717.1 hypothetical protein V502_02801 [Pseudogymnoascus sp. VKM F-4520 (FW-2644)] OAF54596.1 60S ribosomal protein L16 [Pseudogymnoascus destructans] OBT40860.1 60S ribosomal protein L16 [Pseudogymnoascus sp. WSF 3629] OBT76787.1 60S ribosomal protein L16 [Pseudogymnoascus sp. 05NY08] OBT85774.1 60S ribosomal protein L16 [Pseudogymnoascus sp. 03VT05] OBT99718.1 60S ribosomal protein L16 [Pseudogymnoascus verrucosus] Length = 202 Score = 61.6 bits (148), Expect = 2e-09 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVKG AYYERK AA + L EA+K+AK+ TQ+QL +GY Sbjct: 158 LEERRKVKGSAYYERKKAARRQLAEAQKSAKVDTKTQEQLASFGY 202 >XP_001543118.1 60S ribosomal protein L16 [Histoplasma capsulatum NAm1] EDN02300.1 60S ribosomal protein L16 [Histoplasma capsulatum NAm1] Length = 184 Score = 60.8 bits (146), Expect = 2e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVKG AYYERK AA + LV+A+K A + + T+ QL +YGY Sbjct: 140 LEERRKVKGSAYYERKKAARRQLVQAQKTANVDQKTKTQLAEYGY 184 >XP_003016160.1 hypothetical protein ARB_05557 [Trichophyton benhamiae CBS 112371] XP_003022512.1 hypothetical protein TRV_03354 [Trichophyton verrucosum HKI 0517] EFE35515.1 hypothetical protein ARB_05557 [Trichophyton benhamiae CBS 112371] EFE41894.1 hypothetical protein TRV_03354 [Trichophyton verrucosum HKI 0517] Length = 114 Score = 59.3 bits (142), Expect = 3e-09 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVKG AYYERK AA + L++A++ A + T++QL QYGY Sbjct: 70 LEERRKVKGAAYYERKKAARRQLLQAQRTASVDNKTKEQLAQYGY 114 >EDP55936.1 ribosomal protein L16a [Aspergillus fumigatus A1163] KEY82761.1 ribosomal protein L16a [Aspergillus fumigatus var. RP-2014] KMK57160.1 ribosomal protein L16a [Aspergillus fumigatus Z5] Length = 202 Score = 60.8 bits (146), Expect = 3e-09 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVK AYYERK AA + LV+A+K+A I E T+ QL +YGY Sbjct: 158 LEERRKVKSSAYYERKKAARRQLVQAQKSASIDEKTKSQLAEYGY 202 >OAA56547.1 60S ribosomal protein l16 [Sporothrix insectorum RCEF 264] Length = 202 Score = 60.8 bits (146), Expect = 3e-09 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRK KG AYYERK A + L EAKKNAK+ + T K LE +GY Sbjct: 158 LEERRKAKGAAYYERKKVAARQLSEAKKNAKVDQKTAKALEAFGY 202 >EER45034.1 60S ribosomal protein L13a [Histoplasma capsulatum H143] EGC40987.1 60S ribosomal protein [Histoplasma capsulatum H88] Length = 202 Score = 60.8 bits (146), Expect = 3e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVKG AYYERK AA + LV+A+K A + + T+ QL +YGY Sbjct: 158 LEERRKVKGSAYYERKKAARRQLVQAQKTANVDQKTKTQLAEYGY 202 >XP_002625192.1 60S ribosomal protein L16 [Blastomyces gilchristii SLH14081] EEQ83806.1 60S ribosomal protein L16 [Blastomyces dermatitidis ER-3] EGE80145.1 60S ribosomal protein L16 [Blastomyces dermatitidis ATCC 18188] EQL37292.1 60S ribosomal protein L16 [Blastomyces dermatitidis ATCC 26199] OAT08828.1 60S ribosomal protein L16 [Blastomyces gilchristii SLH14081] OJD20695.1 60S ribosomal protein L16 [Blastomyces sp. CAC-2015b] Length = 202 Score = 60.8 bits (146), Expect = 3e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVKG AYYERK AA + LV+A+K A + + T+ QL +YGY Sbjct: 158 LEERRKVKGSAYYERKKAARRQLVQAQKTANVDQKTKAQLAEYGY 202 >EPE08609.1 60s ribosomal protein l16 [Ophiostoma piceae UAMH 11346] Length = 225 Score = 60.8 bits (146), Expect = 4e-09 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRK KG AYYERK A + L EAKKNAK+ T K LE +GY Sbjct: 181 LEERRKAKGAAYYERKKVAARQLTEAKKNAKVDTKTAKALESFGY 225 >KUI57339.1 60S ribosomal protein L16 [Valsa mali var. pyri] KUI63899.1 60S ribosomal protein L16 [Valsa mali] Length = 202 Score = 60.5 bits (145), Expect = 5e-09 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRK KG AYYERK AA + L +AKK+A + E T K LE YGY Sbjct: 158 LEERRKAKGAAYYERKKAARRQLADAKKSATVDEKTAKALEAYGY 202 >GAQ11194.1 60S ribosomal protein L16 [Aspergillus lentulus] Length = 202 Score = 60.5 bits (145), Expect = 5e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRKVK AYYERK AA + LV+A+K+A + E T+ QL +YGY Sbjct: 158 LEERRKVKSSAYYERKKAARRQLVQAQKSASVDEKTKSQLAEYGY 202 >KOS21940.1 60S ribosomal protein L16 [Escovopsis weberi] Length = 202 Score = 60.5 bits (145), Expect = 5e-09 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -3 Query: 292 LEERRKVKGQAYYERKSAAWKNLVEAKKNAKIPEATQKQLEQYGY 158 LEERRK KG AYYERK AA + L EAK NA + E T K LE YGY Sbjct: 158 LEERRKAKGAAYYERKKAAARQLFEAKTNATVKEETVKALEAYGY 202