BLASTX nr result
ID: Phellodendron21_contig00038177
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038177 (335 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003333962.1 hypothetical protein PGTG_15692 [Puccinia gramini... 79 4e-17 KNE93871.1 hypothetical protein PSTG_12783 [Puccinia striiformis... 75 2e-15 OAV92721.1 hypothetical protein PTTG_02511 [Puccinia triticina 1... 75 2e-15 KNZ51190.1 hypothetical protein VP01_4054g1 [Puccinia sorghi] 70 1e-13 >XP_003333962.1 hypothetical protein PGTG_15692 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP89543.1 hypothetical protein PGTG_15692 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 98 Score = 79.3 bits (194), Expect = 4e-17 Identities = 33/61 (54%), Positives = 50/61 (81%) Frame = +1 Query: 19 KFREQSENLKSRGVEISASGMSFRTNLDITQEDLIQRVSHKARVVKDRLASSPGLAQFGQ 198 KF ++S+ LKSRG E+++ G+ RTN+D++QE+L+QR SH+A+VVKD+L + PG+ FGQ Sbjct: 35 KFGKESDKLKSRGFEVTSDGVKIRTNIDLSQEELVQRASHRAQVVKDKLHNQPGMVSFGQ 94 Query: 199 K 201 K Sbjct: 95 K 95 >KNE93871.1 hypothetical protein PSTG_12783 [Puccinia striiformis f. sp. tritici PST-78] Length = 98 Score = 75.1 bits (183), Expect = 2e-15 Identities = 34/67 (50%), Positives = 46/67 (68%) Frame = +1 Query: 1 QRAFQTKFREQSENLKSRGVEISASGMSFRTNLDITQEDLIQRVSHKARVVKDRLASSPG 180 QR KF ++S LK RG EI++ G+ RTN+D+++ED +Q SHKA+V KD+L PG Sbjct: 29 QRKVGEKFDKESGKLKDRGFEITSDGIKIRTNIDLSEEDFVQSASHKAQVAKDKLQHQPG 88 Query: 181 LAQFGQK 201 L FGQK Sbjct: 89 LVSFGQK 95 >OAV92721.1 hypothetical protein PTTG_02511 [Puccinia triticina 1-1 BBBD Race 1] Length = 99 Score = 75.1 bits (183), Expect = 2e-15 Identities = 31/61 (50%), Positives = 49/61 (80%) Frame = +1 Query: 19 KFREQSENLKSRGVEISASGMSFRTNLDITQEDLIQRVSHKARVVKDRLASSPGLAQFGQ 198 KF ++S+ LK+RG E+++ G+ RTN+D++QE+L+QR SH+A+VVKD++ + PG FGQ Sbjct: 35 KFGKESDKLKNRGFELTSDGVRIRTNIDLSQEELVQRASHQAQVVKDKVHNQPGFVSFGQ 94 Query: 199 K 201 K Sbjct: 95 K 95 >KNZ51190.1 hypothetical protein VP01_4054g1 [Puccinia sorghi] Length = 98 Score = 70.5 bits (171), Expect = 1e-13 Identities = 30/61 (49%), Positives = 47/61 (77%) Frame = +1 Query: 19 KFREQSENLKSRGVEISASGMSFRTNLDITQEDLIQRVSHKARVVKDRLASSPGLAQFGQ 198 KF ++++ LKSRG E+++ G+ RTN+D++QE+L+QR SH A+VVK +L + P L FG+ Sbjct: 35 KFGKETDKLKSRGFELTSEGVKIRTNIDLSQEELVQRASHTAQVVKGKLDTQPDLVSFGR 94 Query: 199 K 201 K Sbjct: 95 K 95