BLASTX nr result
ID: Phellodendron21_contig00038152
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038152 (287 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO52516.1 hypothetical protein CISIN_1g020202mg [Citrus sinensi... 74 1e-13 XP_006479008.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 3e-12 XP_008218376.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 6e-11 XP_007206771.1 hypothetical protein PRUPE_ppa025361mg [Prunus pe... 67 6e-11 KDO36418.1 hypothetical protein CISIN_1g041786mg, partial [Citru... 66 8e-11 XP_011097185.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 1e-10 XP_015882041.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 1e-10 XP_010102179.1 hypothetical protein L484_024459 [Morus notabilis... 66 2e-10 XP_016676962.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 XP_017609645.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 XP_009337941.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 OMO50215.1 hypothetical protein COLO4_38175 [Corchorus olitorius] 65 4e-10 XP_016190621.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 4e-10 KZV51962.1 pentatricopeptide repeat-containing protein mitochond... 65 4e-10 XP_017636764.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 5e-10 XP_016680713.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 5e-10 OMO84616.1 hypothetical protein CCACVL1_10744 [Corchorus capsula... 64 5e-10 XP_019461403.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 5e-10 XP_016725195.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 7e-10 GAU34136.1 hypothetical protein TSUD_66150 [Trifolium subterraneum] 64 8e-10 >KDO52516.1 hypothetical protein CISIN_1g020202mg [Citrus sinensis] KDO52517.1 hypothetical protein CISIN_1g020202mg [Citrus sinensis] Length = 329 Score = 73.9 bits (180), Expect = 1e-13 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 IRRMIRK FVPD RTY ILVNA CSSG +R+AQ FLQEMSDK FN PV GR Sbjct: 75 IRRMIRKGFVPDKRTYAILVNAWCSSGKMREAQEFLQEMSDKGFNPPVRGR 125 >XP_006479008.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Citrus sinensis] Length = 445 Score = 70.9 bits (172), Expect = 3e-12 Identities = 39/51 (76%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSS-GIRDAQ*FLQEMSDKRFNQPVLGR 138 IRRMIRK FVPD RTY ILVNA CSS +R+AQ FLQEMSDK FN PV GR Sbjct: 191 IRRMIRKGFVPDKRTYAILVNAWCSSWKMREAQEFLQEMSDKGFNPPVRGR 241 >XP_008218376.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Prunus mume] Length = 460 Score = 67.0 bits (162), Expect = 6e-11 Identities = 35/51 (68%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 +RRMIRK VPD RTY+ILVNA CS+G +R+AQ FL+EMS K FN PV GR Sbjct: 206 VRRMIRKGLVPDKRTYSILVNAWCSNGKMREAQLFLEEMSSKGFNPPVRGR 256 >XP_007206771.1 hypothetical protein PRUPE_ppa025361mg [Prunus persica] ONI05075.1 hypothetical protein PRUPE_6G355300 [Prunus persica] Length = 460 Score = 67.0 bits (162), Expect = 6e-11 Identities = 35/51 (68%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 +RRMIRK VPD RTY+ILVNA CS+G +R+AQ FL+EMS K FN PV GR Sbjct: 206 VRRMIRKGLVPDKRTYSILVNAWCSNGKMREAQLFLEEMSSKGFNPPVRGR 256 >KDO36418.1 hypothetical protein CISIN_1g041786mg, partial [Citrus sinensis] Length = 260 Score = 65.9 bits (159), Expect = 8e-11 Identities = 35/46 (76%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -1 Query: 281 RMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPV 147 RMIRK FVPD RT+TILVNA CSSG +R+AQ FLQE+SDK FN PV Sbjct: 111 RMIRKGFVPDKRTHTILVNAWCSSGKMREAQEFLQELSDKGFNPPV 156 >XP_011097185.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Sesamum indicum] XP_011097186.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Sesamum indicum] Length = 459 Score = 66.2 bits (160), Expect = 1e-10 Identities = 36/51 (70%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 IRRMIRK VPD RTY+ILVNA CS+G +R+AQ FL+EMS K FN PV GR Sbjct: 205 IRRMIRKGSVPDKRTYSILVNAWCSAGKMREAQEFLEEMSKKGFNPPVRGR 255 >XP_015882041.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Ziziphus jujuba] Length = 461 Score = 66.2 bits (160), Expect = 1e-10 Identities = 36/51 (70%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 IRRMIRK VPD RTY+ILVNA CS+G R+AQ FL+EMS K FN PV GR Sbjct: 207 IRRMIRKGVVPDKRTYSILVNAWCSAGKFREAQQFLEEMSKKGFNPPVRGR 257 >XP_010102179.1 hypothetical protein L484_024459 [Morus notabilis] EXB93122.1 hypothetical protein L484_024459 [Morus notabilis] Length = 470 Score = 65.9 bits (159), Expect = 2e-10 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 +RRMIRK VPD RTY+ILVNA CS+G +R+AQ FL EMS K FN PV GR Sbjct: 216 VRRMIRKEVVPDKRTYSILVNAWCSAGKMREAQNFLSEMSKKGFNPPVRGR 266 >XP_016676962.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] XP_016676963.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] XP_016676964.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] XP_016676965.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] XP_016676967.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] Length = 386 Score = 65.5 bits (158), Expect = 2e-10 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 IRRMIRK VPD TYT+LVN CSSG I++AQ FL++MS KRFN PV GR Sbjct: 132 IRRMIRKGKVPDKGTYTVLVNGWCSSGKIKEAQDFLEDMSKKRFNPPVRGR 182 >XP_017609645.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like, partial [Gossypium arboreum] Length = 453 Score = 65.5 bits (158), Expect = 2e-10 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 IRRMIRK VPD TYT+LVN CSSG I++AQ FL++MS KRFN PV GR Sbjct: 199 IRRMIRKGKVPDKGTYTVLVNGWCSSGKIKEAQDFLEDMSKKRFNPPVRGR 249 >XP_009337941.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Pyrus x bretschneideri] Length = 457 Score = 65.5 bits (158), Expect = 2e-10 Identities = 34/51 (66%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 +RRMIRK VPD +TY+ILVNA CS+G +R+AQ FL+EMS K FN PV GR Sbjct: 203 VRRMIRKGVVPDKKTYSILVNAWCSNGKMREAQLFLEEMSSKGFNPPVRGR 253 >OMO50215.1 hypothetical protein COLO4_38175 [Corchorus olitorius] Length = 455 Score = 64.7 bits (156), Expect = 4e-10 Identities = 34/51 (66%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 IRRMIRK VPD RTY++LVN CS+G +R+AQ FL+EMS+K FN PV GR Sbjct: 201 IRRMIRKGEVPDKRTYSVLVNGWCSAGKMREAQEFLEEMSNKGFNPPVRGR 251 >XP_016190621.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Arachis ipaensis] XP_016190624.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Arachis ipaensis] XP_016190625.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Arachis ipaensis] Length = 457 Score = 64.7 bits (156), Expect = 4e-10 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 IRRMIRK PD RTY+ LVNA CS+G +R+AQ FL+EMSDK FN PV GR Sbjct: 203 IRRMIRKGVSPDKRTYSTLVNAWCSNGKMREAQQFLKEMSDKGFNPPVRGR 253 >KZV51962.1 pentatricopeptide repeat-containing protein mitochondrial-like [Dorcoceras hygrometricum] Length = 483 Score = 64.7 bits (156), Expect = 4e-10 Identities = 34/51 (66%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 +RRMIRK VPD RTY+ILVNA CS+G +R+AQ FL+EMS K FN P+ GR Sbjct: 229 VRRMIRKGVVPDKRTYSILVNAWCSAGKMREAQDFLEEMSRKGFNPPLRGR 279 >XP_017636764.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium arboreum] XP_017636765.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium arboreum] XP_017636766.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium arboreum] XP_017636767.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium arboreum] XP_017636768.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium arboreum] Length = 450 Score = 64.3 bits (155), Expect = 5e-10 Identities = 34/51 (66%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 IRRMIRK VPD RTYT+LVN CSSG +++AQ FL++MS K FN PV GR Sbjct: 196 IRRMIRKGEVPDKRTYTVLVNGWCSSGKMKEAQDFLEDMSKKGFNPPVRGR 246 >XP_016680713.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] XP_016680722.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] XP_016680730.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] XP_016680737.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] Length = 450 Score = 64.3 bits (155), Expect = 5e-10 Identities = 34/51 (66%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 IRRMIRK VPD RTYT+LVN CSSG +++AQ FL++MS K FN PV GR Sbjct: 196 IRRMIRKGEVPDKRTYTVLVNGWCSSGKMKEAQDFLEDMSKKGFNPPVRGR 246 >OMO84616.1 hypothetical protein CCACVL1_10744 [Corchorus capsularis] Length = 455 Score = 64.3 bits (155), Expect = 5e-10 Identities = 34/51 (66%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 IRRMIRK VPD RTY +LVN CS+G +R+AQ FL+EMS+K FN PV GR Sbjct: 201 IRRMIRKGEVPDKRTYAVLVNGWCSAGKMREAQEFLEEMSNKGFNPPVRGR 251 >XP_019461403.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial [Lupinus angustifolius] OIW02107.1 hypothetical protein TanjilG_26647 [Lupinus angustifolius] Length = 457 Score = 64.3 bits (155), Expect = 5e-10 Identities = 34/51 (66%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 IRRM+RK PD RTY+ILVNA CS+G +R+AQ FL+EMSDK F+ PV GR Sbjct: 203 IRRMVRKGVSPDKRTYSILVNAWCSNGKMREAQEFLKEMSDKGFSPPVRGR 253 >XP_016725195.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] XP_016725206.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] XP_016725209.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] XP_016725217.1 PREDICTED: pentatricopeptide repeat-containing protein At5g18390, mitochondrial-like [Gossypium hirsutum] Length = 455 Score = 63.9 bits (154), Expect = 7e-10 Identities = 35/51 (68%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSGIR-DAQ*FLQEMSDKRFNQPVLGR 138 IRRMIRK VPD RTYT+LVN CSSG R +AQ FL++MS K FN PV GR Sbjct: 201 IRRMIRKGEVPDKRTYTVLVNGWCSSGKRKEAQDFLEDMSKKGFNPPVRGR 251 >GAU34136.1 hypothetical protein TSUD_66150 [Trifolium subterraneum] Length = 325 Score = 63.5 bits (153), Expect = 8e-10 Identities = 34/51 (66%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -1 Query: 287 IRRMIRKVFVPDIRTYTILVNALCSSG-IRDAQ*FLQEMSDKRFNQPVLGR 138 IRRM+RK PD RTY +LVNA CSSG +R+AQ FL+EMSDK F PV GR Sbjct: 69 IRRMLRKGINPDKRTYALLVNAWCSSGKMREAQQFLKEMSDKGFTPPVRGR 119