BLASTX nr result
ID: Phellodendron21_contig00038146
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038146 (343 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006425741.1 hypothetical protein CICLE_v10027297mg [Citrus cl... 63 4e-09 XP_006466716.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 4e-09 KDO79463.1 hypothetical protein CISIN_1g010057mg [Citrus sinensis] 61 2e-08 >XP_006425741.1 hypothetical protein CICLE_v10027297mg [Citrus clementina] ESR38981.1 hypothetical protein CICLE_v10027297mg [Citrus clementina] Length = 522 Score = 62.8 bits (151), Expect = 4e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 342 YRKEKKRMLADAHSKDTIPMEEKICDLLYAGDGVL 238 YRKEKK + ADA SKDT+PMEEKICDLLY GDGVL Sbjct: 488 YRKEKKSIQADALSKDTVPMEEKICDLLYGGDGVL 522 >XP_006466716.1 PREDICTED: pentatricopeptide repeat-containing protein At2g01390 [Citrus sinensis] Length = 582 Score = 62.8 bits (151), Expect = 4e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -2 Query: 342 YRKEKKRMLADAHSKDTIPMEEKICDLLYAGDGVL 238 YRKEKK + ADA SKDT+PMEEKICDLLY GDGVL Sbjct: 548 YRKEKKSIQADALSKDTVPMEEKICDLLYGGDGVL 582 >KDO79463.1 hypothetical protein CISIN_1g010057mg [Citrus sinensis] Length = 519 Score = 60.8 bits (146), Expect = 2e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 342 YRKEKKRMLADAHSKDTIPMEEKICDLLYAGDGVL 238 YRKEKK + ADA SKD +PMEEKICDLLY GDGVL Sbjct: 485 YRKEKKSIQADALSKDAVPMEEKICDLLYGGDGVL 519