BLASTX nr result
ID: Phellodendron21_contig00038126
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038126 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007417395.1 hypothetical protein MELLADRAFT_112782 [Melampsor... 57 7e-07 >XP_007417395.1 hypothetical protein MELLADRAFT_112782 [Melampsora larici-populina 98AG31] EGF99375.1 hypothetical protein MELLADRAFT_112782 [Melampsora larici-populina 98AG31] Length = 380 Score = 56.6 bits (135), Expect = 7e-07 Identities = 28/76 (36%), Positives = 34/76 (44%) Frame = +1 Query: 154 FTLRDTEWPTSQISTCPSETIHTEEHXXXXXXXXXXXXXXXXEKNSVQPANTKRASVKVI 333 F ++D WP I CPSE N+ + +K S+K I Sbjct: 93 FQVQDPRWPPQTIYLCPSENYSKRHLKSLLNEVVADGIDIHGPSNANNQSGSK--SMKAI 150 Query: 334 AFDMEWCHDWRRKCPR 381 AFDMEWCHDW RKC R Sbjct: 151 AFDMEWCHDWSRKCAR 166