BLASTX nr result
ID: Phellodendron21_contig00038102
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00038102 (326 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015385051.1 PREDICTED: myb-related protein 3R-1 isoform X1 [C... 67 8e-13 XP_006450634.1 hypothetical protein CICLE_v10007316mg [Citrus cl... 67 8e-13 XP_015385052.1 PREDICTED: myb-related protein 3R-1 isoform X2 [C... 67 8e-13 XP_015385053.1 PREDICTED: myb-related protein 3R-1 isoform X3 [C... 67 8e-13 KDO79732.1 hypothetical protein CISIN_1g0473531mg, partial [Citr... 67 8e-13 XP_015385116.1 PREDICTED: LOW QUALITY PROTEIN: myb-related prote... 67 2e-12 XP_012077444.1 PREDICTED: myb-related protein 3R-1 [Jatropha cur... 64 4e-10 XP_010648515.1 PREDICTED: myb-related protein 3R-1 isoform X1 [V... 59 4e-09 XP_002281528.2 PREDICTED: myb-related protein 3R-1 isoform X2 [V... 59 4e-09 OAY45884.1 hypothetical protein MANES_07G099800 [Manihot esculenta] 60 6e-09 XP_018811764.1 PREDICTED: myb-related protein 3R-1-like isoform ... 62 6e-09 XP_018811763.1 PREDICTED: myb-related protein 3R-1-like isoform ... 62 6e-09 XP_018811762.1 PREDICTED: myb-related protein 3R-1-like isoform ... 62 6e-09 XP_018811761.1 PREDICTED: myb-related protein 3R-1-like isoform ... 62 6e-09 XP_018811757.1 PREDICTED: myb-related protein 3R-1-like isoform ... 62 6e-09 XP_018845556.1 PREDICTED: myb-related protein 3R-1 isoform X2 [J... 61 1e-08 XP_018845553.1 PREDICTED: myb-related protein 3R-1 isoform X1 [J... 61 1e-08 GAV91103.1 Myb_DNA-binding domain-containing protein [Cephalotus... 56 2e-08 XP_011019647.1 PREDICTED: myb-related protein 3R-1 [Populus euph... 59 2e-08 XP_002309557.1 myb family transcription factor family protein [P... 59 2e-08 >XP_015385051.1 PREDICTED: myb-related protein 3R-1 isoform X1 [Citrus sinensis] Length = 1046 Score = 66.6 bits (161), Expect(2) = 8e-13 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLLEQF+ LPLVGHQNQ +PSS Sbjct: 179 KNHWNSSVKKKLDSY--------LASGLLEQFQGLPLVGHQNQPLPSS 218 Score = 33.9 bits (76), Expect(2) = 8e-13 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +3 Query: 237 PKGGMEGEEISECSQQ 284 PKGG EGEE+SECSQ+ Sbjct: 231 PKGGTEGEEVSECSQE 246 >XP_006450634.1 hypothetical protein CICLE_v10007316mg [Citrus clementina] ESR63874.1 hypothetical protein CICLE_v10007316mg [Citrus clementina] Length = 1046 Score = 66.6 bits (161), Expect(2) = 8e-13 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLLEQF+ LPLVGHQNQ +PSS Sbjct: 179 KNHWNSSVKKKLDSY--------LASGLLEQFQGLPLVGHQNQPLPSS 218 Score = 33.9 bits (76), Expect(2) = 8e-13 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +3 Query: 237 PKGGMEGEEISECSQQ 284 PKGG EGEE+SECSQ+ Sbjct: 231 PKGGTEGEEVSECSQE 246 >XP_015385052.1 PREDICTED: myb-related protein 3R-1 isoform X2 [Citrus sinensis] Length = 1024 Score = 66.6 bits (161), Expect(2) = 8e-13 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLLEQF+ LPLVGHQNQ +PSS Sbjct: 179 KNHWNSSVKKKLDSY--------LASGLLEQFQGLPLVGHQNQPLPSS 218 Score = 33.9 bits (76), Expect(2) = 8e-13 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +3 Query: 237 PKGGMEGEEISECSQQ 284 PKGG EGEE+SECSQ+ Sbjct: 231 PKGGTEGEEVSECSQE 246 >XP_015385053.1 PREDICTED: myb-related protein 3R-1 isoform X3 [Citrus sinensis] Length = 1005 Score = 66.6 bits (161), Expect(2) = 8e-13 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLLEQF+ LPLVGHQNQ +PSS Sbjct: 179 KNHWNSSVKKKLDSY--------LASGLLEQFQGLPLVGHQNQPLPSS 218 Score = 33.9 bits (76), Expect(2) = 8e-13 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +3 Query: 237 PKGGMEGEEISECSQQ 284 PKGG EGEE+SECSQ+ Sbjct: 231 PKGGTEGEEVSECSQE 246 >KDO79732.1 hypothetical protein CISIN_1g0473531mg, partial [Citrus sinensis] Length = 873 Score = 66.6 bits (161), Expect(2) = 8e-13 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLLEQF+ LPLVGHQNQ +PSS Sbjct: 6 KNHWNSSVKKKLDSY--------LASGLLEQFQGLPLVGHQNQPLPSS 45 Score = 33.9 bits (76), Expect(2) = 8e-13 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = +3 Query: 237 PKGGMEGEEISECSQQ 284 PKGG EGEE+SECSQ+ Sbjct: 58 PKGGTEGEEVSECSQE 73 >XP_015385116.1 PREDICTED: LOW QUALITY PROTEIN: myb-related protein 3R-1-like [Citrus sinensis] Length = 489 Score = 66.6 bits (161), Expect(2) = 2e-12 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLLEQF+ LPLVGHQNQ +PSS Sbjct: 179 KNHWNSSVKKKLDSY--------LASGLLEQFQGLPLVGHQNQPLPSS 218 Score = 32.3 bits (72), Expect(2) = 2e-12 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +3 Query: 237 PKGGMEGEEISECSQQ 284 PKGG EGEE+SECS++ Sbjct: 231 PKGGTEGEEVSECSRE 246 >XP_012077444.1 PREDICTED: myb-related protein 3R-1 [Jatropha curcas] KDP34209.1 hypothetical protein JCGZ_07780 [Jatropha curcas] AIT52223.1 MYB family protein [Jatropha curcas] Length = 1015 Score = 63.5 bits (153), Expect(2) = 4e-10 Identities = 33/48 (68%), Positives = 35/48 (72%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLLEQF+ +PLV HQNQ MPSS Sbjct: 179 KNHWNSSVKKKLDSY--------LASGLLEQFQGVPLVPHQNQTMPSS 218 Score = 27.7 bits (60), Expect(2) = 4e-10 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +3 Query: 237 PKGGMEGEEISECSQQ 284 PK G E EEISECSQ+ Sbjct: 229 PKCGTETEEISECSQE 244 >XP_010648515.1 PREDICTED: myb-related protein 3R-1 isoform X1 [Vitis vinifera] Length = 1052 Score = 58.5 bits (140), Expect(2) = 4e-09 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY +ASGLL QF+ LPLVGH+NQ + SS Sbjct: 179 KNHWNSSVKKKLDSY--------IASGLLAQFQGLPLVGHRNQSIHSS 218 Score = 29.3 bits (64), Expect(2) = 4e-09 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 240 KGGMEGEEISECSQ 281 KGG+E EEISECSQ Sbjct: 233 KGGIEAEEISECSQ 246 >XP_002281528.2 PREDICTED: myb-related protein 3R-1 isoform X2 [Vitis vinifera] Length = 1051 Score = 58.5 bits (140), Expect(2) = 4e-09 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY +ASGLL QF+ LPLVGH+NQ + SS Sbjct: 179 KNHWNSSVKKKLDSY--------IASGLLAQFQGLPLVGHRNQSIHSS 218 Score = 29.3 bits (64), Expect(2) = 4e-09 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +3 Query: 240 KGGMEGEEISECSQ 281 KGG+E EEISECSQ Sbjct: 233 KGGIEAEEISECSQ 246 >OAY45884.1 hypothetical protein MANES_07G099800 [Manihot esculenta] Length = 1037 Score = 60.1 bits (144), Expect(2) = 6e-09 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLLEQF+ +PLV HQNQ M SS Sbjct: 179 KNHWNSSVKKKLDSY--------LASGLLEQFQGVPLVVHQNQPMQSS 218 Score = 27.3 bits (59), Expect(2) = 6e-09 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 237 PKGGMEGEEISECSQQ 284 PK G E EE+SECSQ+ Sbjct: 231 PKCGTETEEVSECSQE 246 >XP_018811764.1 PREDICTED: myb-related protein 3R-1-like isoform X5 [Juglans regia] Length = 1042 Score = 62.0 bits (149), Expect = 6e-09 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLL QF +LP +GHQNQHM SS Sbjct: 179 KNHWNSSVKKKLDSY--------LASGLLAQFPALPHIGHQNQHMHSS 218 >XP_018811763.1 PREDICTED: myb-related protein 3R-1-like isoform X4 [Juglans regia] Length = 1051 Score = 62.0 bits (149), Expect = 6e-09 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLL QF +LP +GHQNQHM SS Sbjct: 179 KNHWNSSVKKKLDSY--------LASGLLAQFPALPHIGHQNQHMHSS 218 >XP_018811762.1 PREDICTED: myb-related protein 3R-1-like isoform X3 [Juglans regia] Length = 1052 Score = 62.0 bits (149), Expect = 6e-09 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLL QF +LP +GHQNQHM SS Sbjct: 179 KNHWNSSVKKKLDSY--------LASGLLAQFPALPHIGHQNQHMHSS 218 >XP_018811761.1 PREDICTED: myb-related protein 3R-1-like isoform X2 [Juglans regia] Length = 1053 Score = 62.0 bits (149), Expect = 6e-09 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLL QF +LP +GHQNQHM SS Sbjct: 179 KNHWNSSVKKKLDSY--------LASGLLAQFPALPHIGHQNQHMHSS 218 >XP_018811757.1 PREDICTED: myb-related protein 3R-1-like isoform X1 [Juglans regia] XP_018811758.1 PREDICTED: myb-related protein 3R-1-like isoform X1 [Juglans regia] XP_018811759.1 PREDICTED: myb-related protein 3R-1-like isoform X1 [Juglans regia] XP_018811760.1 PREDICTED: myb-related protein 3R-1-like isoform X1 [Juglans regia] Length = 1054 Score = 62.0 bits (149), Expect = 6e-09 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLL QF +LP +GHQNQHM SS Sbjct: 179 KNHWNSSVKKKLDSY--------LASGLLAQFPALPHIGHQNQHMHSS 218 >XP_018845556.1 PREDICTED: myb-related protein 3R-1 isoform X2 [Juglans regia] Length = 1039 Score = 61.2 bits (147), Expect = 1e-08 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSYLASGLL Q+ +LPLVGHQ QHM SS Sbjct: 179 KNHWNSSVKKKLDSYLASGLLAQIP--------ALPLVGHQTQHMLSS 218 >XP_018845553.1 PREDICTED: myb-related protein 3R-1 isoform X1 [Juglans regia] XP_018845554.1 PREDICTED: myb-related protein 3R-1 isoform X1 [Juglans regia] XP_018845555.1 PREDICTED: myb-related protein 3R-1 isoform X1 [Juglans regia] Length = 1048 Score = 61.2 bits (147), Expect = 1e-08 Identities = 32/48 (66%), Positives = 34/48 (70%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSYLASGLL Q+ +LPLVGHQ QHM SS Sbjct: 179 KNHWNSSVKKKLDSYLASGLLAQIP--------ALPLVGHQTQHMLSS 218 >GAV91103.1 Myb_DNA-binding domain-containing protein [Cephalotus follicularis] Length = 1029 Score = 55.8 bits (133), Expect(2) = 2e-08 Identities = 30/49 (61%), Positives = 32/49 (65%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSSF 199 KNHWNS V KKLDSY LASGLLEQF+ LPLVG+Q S F Sbjct: 180 KNHWNSSVKKKLDSY--------LASGLLEQFQGLPLVGYQRPTCSSRF 220 Score = 29.6 bits (65), Expect(2) = 2e-08 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 Query: 237 PKGGMEGEEISECSQ 281 P+GG E EEISECSQ Sbjct: 229 PQGGTEAEEISECSQ 243 >XP_011019647.1 PREDICTED: myb-related protein 3R-1 [Populus euphratica] Length = 1028 Score = 58.5 bits (140), Expect(2) = 2e-08 Identities = 31/48 (64%), Positives = 33/48 (68%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLLEQF++ PLVGHQ M SS Sbjct: 181 KNHWNSSVKKKLDSY--------LASGLLEQFQAFPLVGHQTLPMSSS 220 Score = 26.9 bits (58), Expect(2) = 2e-08 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +3 Query: 240 KGGMEGEEISECSQQ 284 +GG E E+ISECSQ+ Sbjct: 234 RGGAEAEDISECSQE 248 >XP_002309557.1 myb family transcription factor family protein [Populus trichocarpa] EEE93080.1 myb family transcription factor family protein [Populus trichocarpa] Length = 1027 Score = 58.5 bits (140), Expect(2) = 2e-08 Identities = 31/48 (64%), Positives = 33/48 (68%) Frame = +2 Query: 53 KNHWNSFVNKKLDSYLASGLLEQLASGLLEQFRSLPLVGHQNQHMPSS 196 KNHWNS V KKLDSY LASGLLEQF++ PLVGHQ M SS Sbjct: 181 KNHWNSSVKKKLDSY--------LASGLLEQFQAFPLVGHQTLPMSSS 220 Score = 26.9 bits (58), Expect(2) = 2e-08 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +3 Query: 240 KGGMEGEEISECSQQ 284 +GG E E+ISECSQ+ Sbjct: 234 RGGAEAEDISECSQE 248