BLASTX nr result
ID: Phellodendron21_contig00037980
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037980 (403 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007417462.1 family 47 glycoside hydrolase [Melampsora larici-... 100 8e-22 KXX76376.1 Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB [Ma... 75 4e-14 KKA29403.1 hypothetical protein TD95_003857 [Thielaviopsis punct... 78 4e-14 KLP00979.1 alpha-mannosidase [Fusarium fujikuroi] 73 7e-14 XP_003054505.1 hypothetical protein NECHADRAFT_31115 [Nectria ha... 77 7e-14 KUI70222.1 Endoplasmic reticulum mannosyl-oligosaccharide 1,2-al... 77 1e-13 KUI60505.1 Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 [... 77 1e-13 XP_016209266.1 hypothetical protein PV09_08939 [Verruconis gallo... 77 1e-13 XP_007757978.1 hypothetical protein A1O7_05780 [Cladophialophora... 76 1e-13 CZT09547.1 probable class I alpha mannosidase [Rhynchosporium co... 76 1e-13 CZT04558.1 related to class I alpha mannosidase [Rhynchosporium ... 76 1e-13 XP_013262679.1 mannosyl-oligosaccharide alpha-1,2-mannosidase [E... 76 1e-13 XP_013322272.1 hypothetical protein PV05_01780 [Exophiala xenobi... 76 1e-13 XP_007792208.1 putative glycoside hydrolase family 47 protein [E... 76 2e-13 KXH66070.1 glycosyl hydrolase family 47 [Colletotrichum salicis] 76 2e-13 KKY30261.1 putative endoplasmic reticulum mannosyl-oligosacchari... 76 2e-13 OCK91494.1 glycoside hydrolase family 47 protein [Cenococcum geo... 76 2e-13 KUI69062.1 Endoplasmic reticulum mannosyl-oligosaccharide 1,2-al... 76 2e-13 KUI61651.1 Endoplasmic reticulum mannosyl-oligosaccharide 1,2-al... 76 2e-13 OBS26723.1 hypothetical protein FPOA_00665 [Fusarium poae] 76 2e-13 >XP_007417462.1 family 47 glycoside hydrolase [Melampsora larici-populina 98AG31] EGF99291.1 family 47 glycoside hydrolase [Melampsora larici-populina 98AG31] Length = 557 Score = 99.8 bits (247), Expect = 8e-22 Identities = 45/67 (67%), Positives = 51/67 (76%) Frame = -2 Query: 402 IEHCCRVSEETGLFAWITDVNRVPTRDFARALRLQEDGPDGWEDEEFREIPEYGDSVESF 223 IE CC VS +TGLFA VNR+PTR+F R+L LQ DG DGWED RE PEYGD +ESF Sbjct: 491 IERCCLVSHQTGLFAPFNQVNRMPTRNFTRSLGLQPDGWDGWEDGPLRESPEYGDFMESF 550 Query: 222 WWAETLK 202 WWAET+K Sbjct: 551 WWAETMK 557 >KXX76376.1 Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB [Madurella mycetomatis] Length = 177 Score = 74.7 bits (182), Expect = 4e-14 Identities = 35/59 (59%), Positives = 42/59 (71%) Frame = -2 Query: 297 EDGPDGWEDEEFREIPEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 EDG D E P DS+ESFW AETLKYFYL+F+ PD+++LDE+VL TEAHP R Sbjct: 116 EDGHSAIHDVSSTEDPVKEDSMESFWLAETLKYFYLLFTTPDVISLDEWVLNTEAHPFR 174 >KKA29403.1 hypothetical protein TD95_003857 [Thielaviopsis punctulata] Length = 606 Score = 77.8 bits (190), Expect = 4e-14 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = -2 Query: 273 DEEFREIPEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 DEE R Y DS+ESFW+AETLKYFYLIFS+PD+++LDE+VL TEAHPLR Sbjct: 554 DEEIR----YLDSMESFWFAETLKYFYLIFSEPDMISLDEWVLNTEAHPLR 600 >KLP00979.1 alpha-mannosidase [Fusarium fujikuroi] Length = 146 Score = 73.2 bits (178), Expect = 7e-14 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = -2 Query: 240 DSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 DS+ESFW++ETLKYFYLIFS+PDL++LDE+VL TEAHP R Sbjct: 101 DSMESFWFSETLKYFYLIFSEPDLISLDEYVLNTEAHPFR 140 >XP_003054505.1 hypothetical protein NECHADRAFT_31115 [Nectria haematococca mpVI 77-13-4] EEU48792.1 hypothetical protein NECHADRAFT_31115 [Nectria haematococca mpVI 77-13-4] Length = 604 Score = 77.0 bits (188), Expect = 7e-14 Identities = 37/51 (72%), Positives = 41/51 (80%) Frame = -2 Query: 273 DEEFREIPEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 DE+ RE+ DS+ESFW ETLKYFYLIFS PDL+NLDEFV TEAHPLR Sbjct: 554 DEKPREV----DSMESFWMGETLKYFYLIFSNPDLINLDEFVFNTEAHPLR 600 >KUI70222.1 Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase [Valsa mali] Length = 574 Score = 76.6 bits (187), Expect = 1e-13 Identities = 37/53 (69%), Positives = 43/53 (81%) Frame = -2 Query: 276 EDEEFREIPEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLRI 118 ED P+ DS+ESFW AETLKYFYLIFS+PDL++LD+FVL TEAHPLRI Sbjct: 519 EDVTRGNSPKKLDSMESFWLAETLKYFYLIFSEPDLMSLDDFVLNTEAHPLRI 571 >KUI60505.1 Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 [Valsa mali var. pyri] Length = 574 Score = 76.6 bits (187), Expect = 1e-13 Identities = 37/53 (69%), Positives = 43/53 (81%) Frame = -2 Query: 276 EDEEFREIPEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLRI 118 ED P+ DS+ESFW AETLKYFYLIFS+PDL++LD+FVL TEAHPLRI Sbjct: 519 EDVTRGNSPKKLDSMESFWLAETLKYFYLIFSEPDLMSLDDFVLNTEAHPLRI 571 >XP_016209266.1 hypothetical protein PV09_08939 [Verruconis gallopava] KIV99396.1 hypothetical protein PV09_08939 [Verruconis gallopava] Length = 608 Score = 76.6 bits (187), Expect = 1e-13 Identities = 32/57 (56%), Positives = 44/57 (77%) Frame = -2 Query: 261 REIPEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLRIDNEWLSRNS 91 +E P+ D+++SFW AETLKYFYL+FS+PD ++LDE+V TEAHPLR+ W + S Sbjct: 541 KEQPDQVDNMQSFWMAETLKYFYLMFSEPDFISLDEWVFNTEAHPLRVPQSWRKKVS 597 >XP_007757978.1 hypothetical protein A1O7_05780 [Cladophialophora yegresii CBS 114405] EXJ58355.1 hypothetical protein A1O7_05780 [Cladophialophora yegresii CBS 114405] Length = 494 Score = 76.3 bits (186), Expect = 1e-13 Identities = 32/44 (72%), Positives = 41/44 (93%) Frame = -2 Query: 240 DSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLRIDNE 109 D +ESFW+AETLKYFYL+FS+PDL++LD+FVL TEAHPLR+ +E Sbjct: 446 DEMESFWFAETLKYFYLLFSEPDLISLDDFVLNTEAHPLRLTDE 489 >CZT09547.1 probable class I alpha mannosidase [Rhynchosporium commune] Length = 551 Score = 76.3 bits (186), Expect = 1e-13 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -2 Query: 252 PEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 P++ DS+ES+W AETLKYFYL+FSKPDLV+LDE+VL TEAHP R Sbjct: 506 PKHEDSMESYWLAETLKYFYLLFSKPDLVSLDEYVLNTEAHPFR 549 >CZT04558.1 related to class I alpha mannosidase [Rhynchosporium agropyri] Length = 569 Score = 76.3 bits (186), Expect = 1e-13 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = -2 Query: 252 PEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 P++ DS+ES+W AETLKYFYL+FSKPDLV+LDE+VL TEAHP R Sbjct: 524 PKHEDSMESYWLAETLKYFYLLFSKPDLVSLDEYVLNTEAHPFR 567 >XP_013262679.1 mannosyl-oligosaccharide alpha-1,2-mannosidase [Exophiala aquamarina CBS 119918] KEF60089.1 mannosyl-oligosaccharide alpha-1,2-mannosidase [Exophiala aquamarina CBS 119918] Length = 596 Score = 76.3 bits (186), Expect = 1e-13 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -2 Query: 261 REIPEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 + IPE D +ESFW AETLKYFYLIFS+P LVNLDE+VL TEAHP R Sbjct: 546 KPIPEKSDRMESFWLAETLKYFYLIFSEPSLVNLDEWVLNTEAHPFR 592 >XP_013322272.1 hypothetical protein PV05_01780 [Exophiala xenobiotica] KIW61688.1 hypothetical protein PV05_01780 [Exophiala xenobiotica] Length = 697 Score = 76.3 bits (186), Expect = 1e-13 Identities = 41/84 (48%), Positives = 50/84 (59%), Gaps = 4/84 (4%) Frame = -2 Query: 360 AW--ITDVNRVPTRDFARAL--RLQEDGPDGWEDEEFREIPEYGDSVESFWWAETLKYFY 193 AW + + +FA A + G DGW P D +ESFW AETLKYFY Sbjct: 619 AWQMFQSIQNITRTEFANAALSEITATGIDGW--------PPKDDRMESFWLAETLKYFY 670 Query: 192 LIFSKPDLVNLDEFVLTTEAHPLR 121 LIFS+P L++LDE+VL TEAHPLR Sbjct: 671 LIFSEPSLISLDEYVLNTEAHPLR 694 >XP_007792208.1 putative glycoside hydrolase family 47 protein [Eutypa lata UCREL1] EMR68694.1 putative glycoside hydrolase family 47 protein [Eutypa lata UCREL1] Length = 568 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -2 Query: 255 IPEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 +PE DS+ESFW AETLKYF+LIFS PDL++LDE+VL TEAHPLR Sbjct: 521 VPEKLDSMESFWLAETLKYFWLIFSSPDLISLDEYVLNTEAHPLR 565 >KXH66070.1 glycosyl hydrolase family 47 [Colletotrichum salicis] Length = 570 Score = 75.9 bits (185), Expect = 2e-13 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 240 DSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 DS+ESFW AETLKYFYLIFS P LVNLDEFVL TEAHPLR Sbjct: 527 DSMESFWMAETLKYFYLIFSSPSLVNLDEFVLNTEAHPLR 566 >KKY30261.1 putative endoplasmic reticulum mannosyl-oligosaccharidealpha-mannosidase [Diaporthe ampelina] Length = 576 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = -2 Query: 252 PEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLRI 118 P+ DS+ESFW AETLKYFYLIFS+PDL++LD++VL TEAHPLRI Sbjct: 529 PKKLDSMESFWLAETLKYFYLIFSEPDLISLDDYVLNTEAHPLRI 573 >OCK91494.1 glycoside hydrolase family 47 protein [Cenococcum geophilum 1.58] Length = 598 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = -2 Query: 258 EIPEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 E P DS+ESFW AETLKYFYL+FS PDL++LDEFVL TEAHP R Sbjct: 550 EYPMQDDSMESFWLAETLKYFYLVFSPPDLISLDEFVLNTEAHPFR 595 >KUI69062.1 Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase [Valsa mali] Length = 605 Score = 75.9 bits (185), Expect = 2e-13 Identities = 35/51 (68%), Positives = 39/51 (76%) Frame = -2 Query: 273 DEEFREIPEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 D R +P DS+ESFW ETLKYFYLIFS+PDLV+LDEFV TEAHP R Sbjct: 551 DMTTRGLPSTTDSMESFWMGETLKYFYLIFSRPDLVSLDEFVFNTEAHPFR 601 >KUI61651.1 Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase [Valsa mali var. pyri] Length = 605 Score = 75.9 bits (185), Expect = 2e-13 Identities = 35/51 (68%), Positives = 39/51 (76%) Frame = -2 Query: 273 DEEFREIPEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 D R +P DS+ESFW ETLKYFYLIFS+PDLV+LDEFV TEAHP R Sbjct: 551 DMTTRGLPSTTDSMESFWMGETLKYFYLIFSRPDLVSLDEFVFNTEAHPFR 601 >OBS26723.1 hypothetical protein FPOA_00665 [Fusarium poae] Length = 607 Score = 75.9 bits (185), Expect = 2e-13 Identities = 35/53 (66%), Positives = 39/53 (73%) Frame = -2 Query: 279 WEDEEFREIPEYGDSVESFWWAETLKYFYLIFSKPDLVNLDEFVLTTEAHPLR 121 W+ E P DS+ESFW ETLKYFYLIFS PDL+NLDE+V TEAHPLR Sbjct: 551 WDVTVAGEKPRAVDSMESFWMGETLKYFYLIFSDPDLINLDEYVFNTEAHPLR 603