BLASTX nr result
ID: Phellodendron21_contig00037964
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037964 (347 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNZ53522.1 uncharacterized protein VP01_3214g2 [Puccinia sorghi] 64 9e-10 OAV87882.1 hypothetical protein PTTG_06772 [Puccinia triticina 1... 63 2e-09 XP_003335707.1 hypothetical protein PGTG_17145 [Puccinia gramini... 63 3e-09 KNE99891.1 hypothetical protein PSTG_06744 [Puccinia striiformis... 63 3e-09 XP_007408773.1 hypothetical protein MELLADRAFT_77485 [Melampsora... 62 7e-09 >KNZ53522.1 uncharacterized protein VP01_3214g2 [Puccinia sorghi] Length = 279 Score = 63.9 bits (154), Expect = 9e-10 Identities = 28/50 (56%), Positives = 41/50 (82%) Frame = -1 Query: 230 QEIRAFLSRPDVDLKTVSLKQIRRHLAEVIPELDVKALKEEINQLIIPIF 81 Q +R++L+ P+VDL+TVS KQIR+ LA + P+LD+KAL+ EI+ + IPIF Sbjct: 9 QHVRSYLTGPEVDLQTVSAKQIRKKLATIFPDLDIKALRSEIDDISIPIF 58 >OAV87882.1 hypothetical protein PTTG_06772 [Puccinia triticina 1-1 BBBD Race 1] Length = 289 Score = 63.2 bits (152), Expect = 2e-09 Identities = 27/48 (56%), Positives = 41/48 (85%) Frame = -1 Query: 224 IRAFLSRPDVDLKTVSLKQIRRHLAEVIPELDVKALKEEINQLIIPIF 81 +R++L+ P+VDL+TVS KQIR+ LA + P+LD+KAL+ EI+++ IPIF Sbjct: 11 VRSYLTSPEVDLQTVSAKQIRKKLATIFPDLDIKALRSEIDEISIPIF 58 >XP_003335707.1 hypothetical protein PGTG_17145 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP91288.1 hypothetical protein PGTG_17145 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 287 Score = 62.8 bits (151), Expect = 3e-09 Identities = 27/48 (56%), Positives = 41/48 (85%) Frame = -1 Query: 224 IRAFLSRPDVDLKTVSLKQIRRHLAEVIPELDVKALKEEINQLIIPIF 81 +R++L+ P+VDL+TVS KQIR+ LA + P+LD+KAL+ EI+++ IPIF Sbjct: 11 VRSYLTGPEVDLQTVSAKQIRKKLATIFPDLDIKALRSEIDEISIPIF 58 >KNE99891.1 hypothetical protein PSTG_06744 [Puccinia striiformis f. sp. tritici PST-78] Length = 317 Score = 62.8 bits (151), Expect = 3e-09 Identities = 27/48 (56%), Positives = 41/48 (85%) Frame = -1 Query: 224 IRAFLSRPDVDLKTVSLKQIRRHLAEVIPELDVKALKEEINQLIIPIF 81 +R++L+ P+VDL+TVS KQIR+ LA + P+LD+KAL+ EI+++ IPIF Sbjct: 11 VRSYLTGPEVDLQTVSAKQIRKKLATIFPDLDIKALRSEIDEISIPIF 58 >XP_007408773.1 hypothetical protein MELLADRAFT_77485 [Melampsora larici-populina 98AG31] EGG08008.1 hypothetical protein MELLADRAFT_77485 [Melampsora larici-populina 98AG31] Length = 304 Score = 61.6 bits (148), Expect = 7e-09 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -1 Query: 227 EIRAFLSRPDVDLKTVSLKQIRRHLAEVIPELDVKALKEEINQLIIPIF 81 E+R++L++PDVDL+ VS KQIRRHL + P LD K K EI+ + IPIF Sbjct: 10 EVRSYLNQPDVDLQLVSAKQIRRHLTTIFPSLDTKLYKTEIDGISIPIF 58