BLASTX nr result
ID: Phellodendron21_contig00037948
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037948 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO52693.1 hypothetical protein CISIN_1g016323mg [Citrus sinensis] 52 5e-06 >KDO52693.1 hypothetical protein CISIN_1g016323mg [Citrus sinensis] Length = 391 Score = 52.4 bits (124), Expect = 5e-06 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = -1 Query: 248 NNSDRNSGGENNDPLCQPVQTRNRYYDYYPNSPASTSTTKGHSDVPLQ 105 N S RNS ENND Q +T+ +YYDYYPN P S+STTK + V L+ Sbjct: 68 NTSVRNSSYENNDRQDQSDRTQIKYYDYYPNLPTSSSTTKRNGAVSLE 115