BLASTX nr result
ID: Phellodendron21_contig00037865
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037865 (516 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006439511.1 hypothetical protein CICLE_v10021507mg [Citrus cl... 64 6e-18 XP_006439507.1 hypothetical protein CICLE_v10021507mg [Citrus cl... 64 6e-18 XP_006439510.1 hypothetical protein CICLE_v10021507mg [Citrus cl... 64 6e-18 XP_006439508.1 hypothetical protein CICLE_v10021507mg [Citrus cl... 64 6e-18 XP_006439505.1 hypothetical protein CICLE_v10021507mg [Citrus cl... 68 1e-16 XP_006439504.1 hypothetical protein CICLE_v10021507mg [Citrus cl... 68 1e-16 >XP_006439511.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] ESR52751.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] Length = 286 Score = 63.9 bits (154), Expect(3) = 6e-18 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 391 VRSKQLNLPHHDMCSASTFATHRFKFDYFARAK 293 VRSKQLNLPHHDMCSASTF THRFKFD FA K Sbjct: 174 VRSKQLNLPHHDMCSASTFETHRFKFDCFAGGK 206 Score = 45.4 bits (106), Expect(3) = 6e-18 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = -1 Query: 450 CCLINFGSRSCLCNFIEFTL 391 CCLINFGSRSC+CNFIEF++ Sbjct: 155 CCLINFGSRSCMCNFIEFSV 174 Score = 28.5 bits (62), Expect(3) = 6e-18 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 512 ILLCCLVRVNDLDFSLKV 459 +L C +VRV DL+FSLKV Sbjct: 133 VLQCSVVRVTDLEFSLKV 150 >XP_006439507.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] ESR52747.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] Length = 274 Score = 63.9 bits (154), Expect(3) = 6e-18 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 391 VRSKQLNLPHHDMCSASTFATHRFKFDYFARAK 293 VRSKQLNLPHHDMCSASTF THRFKFD FA K Sbjct: 162 VRSKQLNLPHHDMCSASTFETHRFKFDCFAGGK 194 Score = 45.4 bits (106), Expect(3) = 6e-18 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = -1 Query: 450 CCLINFGSRSCLCNFIEFTL 391 CCLINFGSRSC+CNFIEF++ Sbjct: 143 CCLINFGSRSCMCNFIEFSV 162 Score = 28.5 bits (62), Expect(3) = 6e-18 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 512 ILLCCLVRVNDLDFSLKV 459 +L C +VRV DL+FSLKV Sbjct: 121 VLQCSVVRVTDLEFSLKV 138 >XP_006439510.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] ESR52750.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] Length = 230 Score = 63.9 bits (154), Expect(3) = 6e-18 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 391 VRSKQLNLPHHDMCSASTFATHRFKFDYFARAK 293 VRSKQLNLPHHDMCSASTF THRFKFD FA K Sbjct: 174 VRSKQLNLPHHDMCSASTFETHRFKFDCFAGGK 206 Score = 45.4 bits (106), Expect(3) = 6e-18 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = -1 Query: 450 CCLINFGSRSCLCNFIEFTL 391 CCLINFGSRSC+CNFIEF++ Sbjct: 155 CCLINFGSRSCMCNFIEFSV 174 Score = 28.5 bits (62), Expect(3) = 6e-18 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 512 ILLCCLVRVNDLDFSLKV 459 +L C +VRV DL+FSLKV Sbjct: 133 VLQCSVVRVTDLEFSLKV 150 >XP_006439508.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] ESR52748.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] Length = 218 Score = 63.9 bits (154), Expect(3) = 6e-18 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -3 Query: 391 VRSKQLNLPHHDMCSASTFATHRFKFDYFARAK 293 VRSKQLNLPHHDMCSASTF THRFKFD FA K Sbjct: 162 VRSKQLNLPHHDMCSASTFETHRFKFDCFAGGK 194 Score = 45.4 bits (106), Expect(3) = 6e-18 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = -1 Query: 450 CCLINFGSRSCLCNFIEFTL 391 CCLINFGSRSC+CNFIEF++ Sbjct: 143 CCLINFGSRSCMCNFIEFSV 162 Score = 28.5 bits (62), Expect(3) = 6e-18 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 512 ILLCCLVRVNDLDFSLKV 459 +L C +VRV DL+FSLKV Sbjct: 121 VLQCSVVRVTDLEFSLKV 138 >XP_006439505.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] XP_006439506.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] ESR52745.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] ESR52746.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] Length = 214 Score = 67.8 bits (164), Expect(2) = 1e-16 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = -3 Query: 391 VRSKQLNLPHHDMCSASTFATHRFKFDYFARAKCPFF 281 VRSKQLNLPHHDMCSASTF THRFKFD FA PFF Sbjct: 174 VRSKQLNLPHHDMCSASTFETHRFKFDCFAGGCTPFF 210 Score = 45.4 bits (106), Expect(2) = 1e-16 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = -1 Query: 450 CCLINFGSRSCLCNFIEFTL 391 CCLINFGSRSC+CNFIEF++ Sbjct: 155 CCLINFGSRSCMCNFIEFSV 174 >XP_006439504.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] XP_006439509.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] ESR52744.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] ESR52749.1 hypothetical protein CICLE_v10021507mg [Citrus clementina] Length = 202 Score = 67.8 bits (164), Expect(2) = 1e-16 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = -3 Query: 391 VRSKQLNLPHHDMCSASTFATHRFKFDYFARAKCPFF 281 VRSKQLNLPHHDMCSASTF THRFKFD FA PFF Sbjct: 162 VRSKQLNLPHHDMCSASTFETHRFKFDCFAGGCTPFF 198 Score = 45.4 bits (106), Expect(2) = 1e-16 Identities = 17/20 (85%), Positives = 20/20 (100%) Frame = -1 Query: 450 CCLINFGSRSCLCNFIEFTL 391 CCLINFGSRSC+CNFIEF++ Sbjct: 143 CCLINFGSRSCMCNFIEFSV 162