BLASTX nr result
ID: Phellodendron21_contig00037859
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037859 (439 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415802.1 hypothetical protein MELLADRAFT_117940 [Melampsor... 65 1e-09 >XP_007415802.1 hypothetical protein MELLADRAFT_117940 [Melampsora larici-populina 98AG31] EGG00954.1 hypothetical protein MELLADRAFT_117940 [Melampsora larici-populina 98AG31] Length = 1396 Score = 65.5 bits (158), Expect = 1e-09 Identities = 34/69 (49%), Positives = 46/69 (66%) Frame = -3 Query: 398 PCKSTKFQTGPHQPQQRSNSLEEIRIKCDTAKRAHRTNAQKAWEEMYQSRLEREQWRAES 219 P K T+ T P + S SLE ++ + A +A RT+AQ+AW+E+Y+ RLERE WRAE+ Sbjct: 499 PRKLTRSVTNP----RISQSLEALKQRAAAAAQAERTHAQRAWDEIYRLRLERELWRAEA 554 Query: 218 EASCTAVLF 192 EASC LF Sbjct: 555 EASCNPSLF 563