BLASTX nr result
ID: Phellodendron21_contig00037831
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037831 (610 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO49910.1 hypothetical protein CISIN_1g010885mg [Citrus sinensis] 64 2e-08 GAV68087.1 AAA_17 domain-containing protein [Cephalotus follicul... 56 9e-06 >KDO49910.1 hypothetical protein CISIN_1g010885mg [Citrus sinensis] Length = 498 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -2 Query: 273 QGLTVVNSSATTFPQALGWLHGYLLQVYLFYS*C-YKCFLV 154 QG+TVVN SATTFPQ L WLHGYLLQVYLFY C K FL+ Sbjct: 428 QGVTVVNVSATTFPQTLDWLHGYLLQVYLFYIQCRVKAFLI 468 >GAV68087.1 AAA_17 domain-containing protein [Cephalotus follicularis] Length = 441 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -2 Query: 273 QGLTVVNSSATTFPQALGWLHGYLLQVYLF 184 QGLTVVN SATTFPQ L WLHGYLLQV LF Sbjct: 404 QGLTVVNISATTFPQTLDWLHGYLLQVLLF 433