BLASTX nr result
ID: Phellodendron21_contig00037805
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037805 (433 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNZ55730.1 30S ribosomal protein S17 [Puccinia sorghi] 80 5e-17 OAV87833.1 hypothetical protein PTTG_07148, partial [Puccinia tr... 80 9e-17 XP_003327058.2 hypothetical protein PGTG_08835 [Puccinia gramini... 78 3e-16 KNE89168.1 30S ribosomal protein S17 [Puccinia striiformis f. sp... 75 6e-15 >KNZ55730.1 30S ribosomal protein S17 [Puccinia sorghi] Length = 87 Score = 80.1 bits (196), Expect = 5e-17 Identities = 36/77 (46%), Positives = 54/77 (70%) Frame = -2 Query: 324 LTRPLIGIVHPSRLGHKTIKVITTSYVLHPIVPKAIPKKSTYIVHDPHKISKPGDRVELV 145 + +P++G+V S + KT+KV+ T+ VLH +VPKAI K Y VHD +K GD+VE+V Sbjct: 9 IVKPVVGVVIQSGVQSKTVKVLRTTQVLHRVVPKAIKKNIVYSVHDEKNSAKRGDKVEIV 68 Query: 144 PIGSRLSPNKTFKVNRV 94 P G R+S NKT+ ++R+ Sbjct: 69 PTGRRISTNKTYALSRI 85 >OAV87833.1 hypothetical protein PTTG_07148, partial [Puccinia triticina 1-1 BBBD Race 1] Length = 114 Score = 80.1 bits (196), Expect = 9e-17 Identities = 34/78 (43%), Positives = 55/78 (70%) Frame = -2 Query: 327 PLTRPLIGIVHPSRLGHKTIKVITTSYVLHPIVPKAIPKKSTYIVHDPHKISKPGDRVEL 148 P+ +P++G+V S + KT+KV+ T+ VLH +VPKAI K Y VHD ++ GD+VE+ Sbjct: 35 PIAKPVVGVVIQSGIQPKTVKVLRTTQVLHRVVPKAIKKSVVYTVHDEKNSARRGDKVEI 94 Query: 147 VPIGSRLSPNKTFKVNRV 94 +P G R+S NKT+ ++++ Sbjct: 95 IPAGRRISTNKTYALSQI 112 >XP_003327058.2 hypothetical protein PGTG_08835 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP82639.2 30S ribosomal protein S17 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 91 Score = 78.2 bits (191), Expect = 3e-16 Identities = 34/77 (44%), Positives = 54/77 (70%) Frame = -2 Query: 324 LTRPLIGIVHPSRLGHKTIKVITTSYVLHPIVPKAIPKKSTYIVHDPHKISKPGDRVELV 145 + +P++G+V S + KT+KV+ T+ VLH +VPKAI K Y VHD ++ GD+VE++ Sbjct: 10 IVKPVVGVVIQSGVQPKTVKVLRTTQVLHRVVPKAIKKTVVYTVHDEKNSARRGDKVEII 69 Query: 144 PIGSRLSPNKTFKVNRV 94 P G R+S NKT+ ++R+ Sbjct: 70 PAGRRISTNKTYALSRI 86 >KNE89168.1 30S ribosomal protein S17 [Puccinia striiformis f. sp. tritici PST-78] KNF03325.1 30S ribosomal protein S17 [Puccinia striiformis f. sp. tritici PST-78] Length = 88 Score = 74.7 bits (182), Expect = 6e-15 Identities = 34/75 (45%), Positives = 52/75 (69%) Frame = -2 Query: 318 RPLIGIVHPSRLGHKTIKVITTSYVLHPIVPKAIPKKSTYIVHDPHKISKPGDRVELVPI 139 +P++G+V S + KT+KV+ TS VLH +VPKA+ K Y VHD + GD+VE+VP Sbjct: 12 KPVVGVVIQSGVHPKTLKVLKTSQVLHRVVPKAMNKTVVYTVHDEKSKANRGDKVEIVPT 71 Query: 138 GSRLSPNKTFKVNRV 94 G R+S NKT+ ++++ Sbjct: 72 GRRISANKTYTLSKI 86