BLASTX nr result
ID: Phellodendron21_contig00037730
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037730 (357 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007404440.1 hypothetical protein MELLADRAFT_115131 [Melampsor... 65 7e-10 OAV99686.1 hypothetical protein PTTG_11715 [Puccinia triticina 1... 55 2e-06 KNE89943.1 hypothetical protein PSTG_16588 [Puccinia striiformis... 55 2e-06 >XP_007404440.1 hypothetical protein MELLADRAFT_115131 [Melampsora larici-populina 98AG31] EGG12065.1 hypothetical protein MELLADRAFT_115131 [Melampsora larici-populina 98AG31] Length = 809 Score = 65.1 bits (157), Expect = 7e-10 Identities = 39/98 (39%), Positives = 55/98 (56%), Gaps = 4/98 (4%) Frame = -3 Query: 283 MSPTHHERTPLLSSSPVDS--KLHYPSETFTWNN--YVKXXXXXXXXXXXXXXXXXXXXX 116 M+ HHER PLL S+ + LH + N+ Y+K Sbjct: 74 MASPHHEREPLLPSNQQSTCQNLHQKASQTISNSFRYLKLRPRPRTLLFTSLLLISSAIV 133 Query: 115 XLYNRTNQRDLVDQLANSIESLSTCASCKALLVPFVTL 2 LY+R+ +RDL+D+LA++IE+LSTCASCKALL+P VT+ Sbjct: 134 YLYDRSQKRDLIDELADTIENLSTCASCKALLLPLVTI 171 >OAV99686.1 hypothetical protein PTTG_11715 [Puccinia triticina 1-1 BBBD Race 1] Length = 708 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -3 Query: 109 YNRTNQRDLVDQLANSIESLSTCASCKALLVPFVTL 2 Y+R+ +RDLVDQLA+S+E+LSTCASC ALLVP + + Sbjct: 54 YSRSTRRDLVDQLAHSLENLSTCASCHALLVPLIAI 89 >KNE89943.1 hypothetical protein PSTG_16588 [Puccinia striiformis f. sp. tritici PST-78] Length = 714 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -3 Query: 109 YNRTNQRDLVDQLANSIESLSTCASCKALLVPFVTL 2 YN RDLVDQLA+SIE+LSTCASC+ALL+P +++ Sbjct: 54 YNAYTHRDLVDQLAHSIENLSTCASCQALLIPLISI 89