BLASTX nr result
ID: Phellodendron21_contig00037725
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037725 (413 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018264212.1 hypothetical protein I303_04094 [Kwoniella deject... 64 3e-09 XP_019013200.1 hypothetical protein I206_01265 [Kwoniella pini C... 63 8e-09 >XP_018264212.1 hypothetical protein I303_04094 [Kwoniella dejecticola CBS 10117] OBR86370.1 hypothetical protein I303_04094 [Kwoniella dejecticola CBS 10117] Length = 666 Score = 63.9 bits (154), Expect = 3e-09 Identities = 36/100 (36%), Positives = 56/100 (56%), Gaps = 1/100 (1%) Frame = +1 Query: 115 IFTIISAFLK-LALCAGAAVKVTQNSNTIVLQNSRLQIILATAKGRYTPGSITHVALDGI 291 +FT++ +L L+ A + VT ++ T+ LQN R+ ++ T +T V DG+ Sbjct: 2 MFTLLGLYLLGLSTVVTAFLNVTDSNGTLSLQNDRVLFVM-----NKTTSYMTKVIFDGV 56 Query: 292 SMLGNSTGSKSGIGPYMDYVGNKKQVNLVPGAYANYSIFQ 411 +LG + S IGPY+D + KQ N VPGA A+YS+ Q Sbjct: 57 DLLGTPVDATSAIGPYVDAILTPKQDNYVPGATADYSVVQ 96 >XP_019013200.1 hypothetical protein I206_01265 [Kwoniella pini CBS 10737] OCF51981.1 hypothetical protein I206_01265 [Kwoniella pini CBS 10737] Length = 665 Score = 62.8 bits (151), Expect = 8e-09 Identities = 37/91 (40%), Positives = 49/91 (53%) Frame = +1 Query: 139 LKLALCAGAAVKVTQNSNTIVLQNSRLQIILATAKGRYTPGSITHVALDGISMLGNSTGS 318 L L A + VT+ + T+ LQN R+ I+ T IT V DG+++LG + Sbjct: 10 LGLTNIVSAFLNVTETNGTLSLQNDRVLFIM-----NKTTSYITTVIFDGVNLLGTPVDA 64 Query: 319 KSGIGPYMDYVGNKKQVNLVPGAYANYSIFQ 411 S IGPY D + KQ N VPGA A+YSI Q Sbjct: 65 TSAIGPYADAILTPKQDNYVPGATADYSIVQ 95