BLASTX nr result
ID: Phellodendron21_contig00037659
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037659 (552 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM34408.1 hypothetical protein LR48_Vigan02g055800 [Vigna angul... 50 2e-06 KJB09768.1 hypothetical protein B456_001G163500 [Gossypium raimo... 55 5e-06 >KOM34408.1 hypothetical protein LR48_Vigan02g055800 [Vigna angularis] Length = 382 Score = 49.7 bits (117), Expect(2) = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = -3 Query: 133 GRCKARNWNVLILLLHVLCFRACPSV*SVL 44 GRCKARNWN LI L+ VL FRACPSV SVL Sbjct: 311 GRCKARNWNTLIPLVPVLRFRACPSVWSVL 340 Score = 29.3 bits (64), Expect(2) = 2e-06 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 56 VISTPGQRCLHLFTNYDG 3 V+ T GQR LHL T+YDG Sbjct: 339 VLHTVGQRSLHLLTHYDG 356 >KJB09768.1 hypothetical protein B456_001G163500 [Gossypium raimondii] Length = 184 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 134 WSVQGQKLERIDSAPSRPLLQSLSLGVISTP 42 WSVQGQKLE IDSA SRP LQ LSLGV+STP Sbjct: 115 WSVQGQKLEHIDSARSRPALQGLSLGVVSTP 145