BLASTX nr result
ID: Phellodendron21_contig00037387
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037387 (389 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016757026.1 ribosomal protein S1 [Sphaerulina musiva SO2202] ... 159 5e-48 XP_003848554.1 40S ribosomal protein S20 [Zymoseptoria tritici I... 148 9e-44 KXT10269.1 hypothetical protein AC579_6609 [Pseudocercospora musae] 147 3e-43 KXS99403.1 hypothetical protein AC578_8151 [Mycosphaerella eumusae] 144 3e-42 XP_013431659.1 ribosomal protein S1 [Aureobasidium namibiae CBS ... 144 4e-42 KEQ67107.1 ribosomal protein S1 [Aureobasidium melanogenum CBS 1... 144 4e-42 EME40292.1 hypothetical protein DOTSEDRAFT_74932 [Dothistroma se... 144 4e-42 KXL49812.1 hypothetical protein FE78DRAFT_257318 [Acidomyces ric... 142 1e-41 XP_007672514.1 hypothetical protein BAUCODRAFT_30455 [Baudoinia ... 142 2e-41 XP_013342060.1 hypothetical protein AUEXF2481DRAFT_41779 [Aureob... 139 3e-40 GAM83257.1 hypothetical protein ANO11243_012430 [fungal sp. No.1... 135 6e-39 XP_007931674.1 hypothetical protein MYCFIDRAFT_113540, partial [... 132 8e-38 XP_013265411.1 40S ribosomal protein S20 [Exophiala aquamarina C... 130 1e-36 XP_013268055.1 40S ribosomal protein S20 [Rhinocladiella mackenz... 129 2e-36 XP_006692481.1 40S ribosomal protein S20-like protein [Chaetomiu... 129 2e-36 XP_013311099.1 40S ribosomal protein S20 [Exophiala xenobiotica]... 129 2e-36 KIV83685.1 40S ribosomal protein S20 [Exophiala sideris] 129 2e-36 XP_009158988.1 40S ribosomal protein S20 [Exophiala dermatitidis... 129 2e-36 KUI60172.1 40S ribosomal protein S20 [Valsa mali var. pyri] KUI6... 128 5e-36 XP_016257645.1 40S ribosomal protein S20 [Exophiala oligosperma]... 128 7e-36 >XP_016757026.1 ribosomal protein S1 [Sphaerulina musiva SO2202] EMF08905.1 ribosomal protein S1 [Sphaerulina musiva SO2202] Length = 117 Score = 159 bits (401), Expect = 5e-48 Identities = 78/79 (98%), Positives = 79/79 (100%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVC+ELIERAKSKELRVKGPVRMPTKN Sbjct: 1 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCTELIERAKSKELRVKGPVRMPTKN 60 Query: 332 LKISTRKTPCGEGSKTWDM 388 LKISTRKTPCGEGSKTWDM Sbjct: 61 LKISTRKTPCGEGSKTWDM 79 >XP_003848554.1 40S ribosomal protein S20 [Zymoseptoria tritici IPO323] EGP83530.1 hypothetical protein MYCGRDRAFT_88095 [Zymoseptoria tritici IPO323] KJX92176.1 40s ribosomal protein s20 [Zymoseptoria brevis] Length = 117 Score = 148 bits (373), Expect = 9e-44 Identities = 72/79 (91%), Positives = 75/79 (94%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQDAKKGG DAPKIHKIRITLTS+KV +LEKVC ELIERAKSKELRVKGPVR+PTKN Sbjct: 1 MSFQDAKKGGQGDAPKIHKIRITLTSKKVTALEKVCGELIERAKSKELRVKGPVRLPTKN 60 Query: 332 LKISTRKTPCGEGSKTWDM 388 LKISTRKTPCGEGSKTWDM Sbjct: 61 LKISTRKTPCGEGSKTWDM 79 >KXT10269.1 hypothetical protein AC579_6609 [Pseudocercospora musae] Length = 117 Score = 147 bits (370), Expect = 3e-43 Identities = 72/79 (91%), Positives = 74/79 (93%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQD KK LD PKIHKIRITLTSRKVQ+LEKVC+ELIERAKSKELRVKGPVRMPTKN Sbjct: 1 MSFQDPKKTSQLDQPKIHKIRITLTSRKVQALEKVCTELIERAKSKELRVKGPVRMPTKN 60 Query: 332 LKISTRKTPCGEGSKTWDM 388 LKISTRKTPCGEGSKTWDM Sbjct: 61 LKISTRKTPCGEGSKTWDM 79 >KXS99403.1 hypothetical protein AC578_8151 [Mycosphaerella eumusae] Length = 117 Score = 144 bits (363), Expect = 3e-42 Identities = 70/79 (88%), Positives = 73/79 (92%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQD KK LD PKIHKIRITLTSRKVQ+LEKVC+ELI+RAK KELRVKGPVRMPTKN Sbjct: 1 MSFQDPKKTSQLDQPKIHKIRITLTSRKVQALEKVCTELIDRAKGKELRVKGPVRMPTKN 60 Query: 332 LKISTRKTPCGEGSKTWDM 388 LKISTRKTPCGEGSKTWDM Sbjct: 61 LKISTRKTPCGEGSKTWDM 79 >XP_013431659.1 ribosomal protein S1 [Aureobasidium namibiae CBS 147.97] KEQ77355.1 ribosomal protein S1 [Aureobasidium namibiae CBS 147.97] KEQ80157.1 ribosomal protein S1 [Aureobasidium pullulans EXF-150] Length = 117 Score = 144 bits (362), Expect = 4e-42 Identities = 69/78 (88%), Positives = 74/78 (94%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQD KK G DAPKIHKIRITLTSRKVQSLEKVC+ELI+RAKSK+LRVKGPVR+PTKN Sbjct: 1 MSFQDPKKTGQADAPKIHKIRITLTSRKVQSLEKVCTELIDRAKSKDLRVKGPVRLPTKN 60 Query: 332 LKISTRKTPCGEGSKTWD 385 LKI+TRKTPCGEGSKTWD Sbjct: 61 LKITTRKTPCGEGSKTWD 78 >KEQ67107.1 ribosomal protein S1 [Aureobasidium melanogenum CBS 110374] Length = 117 Score = 144 bits (362), Expect = 4e-42 Identities = 69/78 (88%), Positives = 74/78 (94%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQD KK G DAPKIHKIRITLTSRKVQSLEKVC+ELI+RAKSK+LRVKGPVR+PTKN Sbjct: 1 MSFQDPKKTGQADAPKIHKIRITLTSRKVQSLEKVCTELIDRAKSKDLRVKGPVRLPTKN 60 Query: 332 LKISTRKTPCGEGSKTWD 385 LKI+TRKTPCGEGSKTWD Sbjct: 61 LKITTRKTPCGEGSKTWD 78 >EME40292.1 hypothetical protein DOTSEDRAFT_74932 [Dothistroma septosporum NZE10] Length = 117 Score = 144 bits (362), Expect = 4e-42 Identities = 70/79 (88%), Positives = 73/79 (92%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQD KK LDAPKIHKIRITLTSRKV +LEKVC ELI+RAKSKELRVKGPVR+PTKN Sbjct: 1 MSFQDPKKTSQLDAPKIHKIRITLTSRKVAALEKVCDELIQRAKSKELRVKGPVRLPTKN 60 Query: 332 LKISTRKTPCGEGSKTWDM 388 LKISTRKTPCGEGSKTWDM Sbjct: 61 LKISTRKTPCGEGSKTWDM 79 >KXL49812.1 hypothetical protein FE78DRAFT_257318 [Acidomyces richmondensis] KYG44309.1 hypothetical protein M433DRAFT_309096 [Acidomyces richmondensis BFW] Length = 117 Score = 142 bits (359), Expect = 1e-41 Identities = 70/79 (88%), Positives = 73/79 (92%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQDAKK +APKIHKIRITLTSRKV SLEKVC ELIERAKSKELRVKGPVR+PTK+ Sbjct: 1 MSFQDAKKASQHEAPKIHKIRITLTSRKVASLEKVCGELIERAKSKELRVKGPVRLPTKH 60 Query: 332 LKISTRKTPCGEGSKTWDM 388 LKISTRKTPCGEGSKTWDM Sbjct: 61 LKISTRKTPCGEGSKTWDM 79 >XP_007672514.1 hypothetical protein BAUCODRAFT_30455 [Baudoinia panamericana UAMH 10762] EMD00014.1 hypothetical protein BAUCODRAFT_30455 [Baudoinia panamericana UAMH 10762] Length = 117 Score = 142 bits (358), Expect = 2e-41 Identities = 70/78 (89%), Positives = 72/78 (92%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQD KK +D PKIHKIRITLTSRKV SLEKVCSELIERAKSKELRVKGPVRMPTK+ Sbjct: 1 MSFQDPKKTSQIDQPKIHKIRITLTSRKVASLEKVCSELIERAKSKELRVKGPVRMPTKH 60 Query: 332 LKISTRKTPCGEGSKTWD 385 LKISTRKTPCGEGSKTWD Sbjct: 61 LKISTRKTPCGEGSKTWD 78 >XP_013342060.1 hypothetical protein AUEXF2481DRAFT_41779 [Aureobasidium subglaciale EXF-2481] KEQ93540.1 hypothetical protein AUEXF2481DRAFT_41779 [Aureobasidium subglaciale EXF-2481] Length = 117 Score = 139 bits (350), Expect = 3e-40 Identities = 68/78 (87%), Positives = 73/78 (93%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQD KK G DAPKIHKIRITLTSRKVQSLEKVC+ELI+RAKSK+LRVKGPVR+PTKN Sbjct: 1 MSFQDPKKTGQADAPKIHKIRITLTSRKVQSLEKVCTELIDRAKSKDLRVKGPVRLPTKN 60 Query: 332 LKISTRKTPCGEGSKTWD 385 LKI+TRKTP GEGSKTWD Sbjct: 61 LKITTRKTPNGEGSKTWD 78 >GAM83257.1 hypothetical protein ANO11243_012430 [fungal sp. No.11243] Length = 116 Score = 135 bits (341), Expect = 6e-39 Identities = 68/78 (87%), Positives = 73/78 (93%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQD KK LDAPKIHKIRITLTSRKVQSLEKVCSELIERAK+K+LRVKGPVR+PTKN Sbjct: 1 MSFQDQKKS-QLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKTKDLRVKGPVRLPTKN 59 Query: 332 LKISTRKTPCGEGSKTWD 385 LK++TRKTP GEGSKTWD Sbjct: 60 LKVTTRKTPNGEGSKTWD 77 >XP_007931674.1 hypothetical protein MYCFIDRAFT_113540, partial [Pseudocercospora fijiensis CIRAD86] EME77935.1 hypothetical protein MYCFIDRAFT_113540, partial [Pseudocercospora fijiensis CIRAD86] Length = 105 Score = 132 bits (333), Expect = 8e-38 Identities = 64/67 (95%), Positives = 66/67 (98%) Frame = +2 Query: 188 DAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKNLKISTRKTPCGE 367 D PKIHKIRITLTSRKVQ+LEKVC+ELIERAKSKELRVKGPVRMPTKNLKISTRKTPCGE Sbjct: 1 DQPKIHKIRITLTSRKVQALEKVCTELIERAKSKELRVKGPVRMPTKNLKISTRKTPCGE 60 Query: 368 GSKTWDM 388 GSKTWDM Sbjct: 61 GSKTWDM 67 >XP_013265411.1 40S ribosomal protein S20 [Exophiala aquamarina CBS 119918] KEF62821.1 40S ribosomal protein S20 [Exophiala aquamarina CBS 119918] Length = 116 Score = 130 bits (326), Expect = 1e-36 Identities = 64/79 (81%), Positives = 71/79 (89%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQ +K + PKIHKIRITLTSRKVQSLEKVCSEL+ERAKSK+LRVKGPVR+PTK Sbjct: 1 MSFQKPEKDFG-EGPKIHKIRITLTSRKVQSLEKVCSELLERAKSKQLRVKGPVRLPTKT 59 Query: 332 LKISTRKTPCGEGSKTWDM 388 LK++TRKTPCGEGSKTWDM Sbjct: 60 LKVTTRKTPCGEGSKTWDM 78 >XP_013268055.1 40S ribosomal protein S20 [Rhinocladiella mackenziei CBS 650.93] KIX00919.1 40S ribosomal protein S20 [Rhinocladiella mackenziei CBS 650.93] Length = 116 Score = 129 bits (325), Expect = 2e-36 Identities = 64/79 (81%), Positives = 71/79 (89%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQ +K + + PKIHKIRITLTSRKVQSLEKVCSEL+ERAKSK LRVKGPVR+PTK Sbjct: 1 MSFQKPEKDFA-EGPKIHKIRITLTSRKVQSLEKVCSELLERAKSKNLRVKGPVRLPTKT 59 Query: 332 LKISTRKTPCGEGSKTWDM 388 LK++TRKTPCGEGSKTWDM Sbjct: 60 LKVTTRKTPCGEGSKTWDM 78 >XP_006692481.1 40S ribosomal protein S20-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] EGS22462.1 40S ribosomal protein S20-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 116 Score = 129 bits (325), Expect = 2e-36 Identities = 64/78 (82%), Positives = 71/78 (91%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MS+Q A+K +APK+HKIRITLTSRKVQSLEKVC ELIERAK+K+LRVKGPVRMPTK Sbjct: 1 MSYQKAEKDFG-EAPKVHKIRITLTSRKVQSLEKVCQELIERAKNKDLRVKGPVRMPTKT 59 Query: 332 LKISTRKTPCGEGSKTWD 385 LKI+TRKTPCGEGSKTWD Sbjct: 60 LKITTRKTPCGEGSKTWD 77 >XP_013311099.1 40S ribosomal protein S20 [Exophiala xenobiotica] KIW50515.1 40S ribosomal protein S20 [Exophiala xenobiotica] Length = 116 Score = 129 bits (324), Expect = 2e-36 Identities = 64/79 (81%), Positives = 70/79 (88%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQ +K + PKIHKIRITLTSRKVQSLEKVCSEL+ERAKSK LRVKGPVR+PTK Sbjct: 1 MSFQKPEKDFG-EGPKIHKIRITLTSRKVQSLEKVCSELLERAKSKHLRVKGPVRLPTKT 59 Query: 332 LKISTRKTPCGEGSKTWDM 388 LK++TRKTPCGEGSKTWDM Sbjct: 60 LKVTTRKTPCGEGSKTWDM 78 >KIV83685.1 40S ribosomal protein S20 [Exophiala sideris] Length = 116 Score = 129 bits (324), Expect = 2e-36 Identities = 64/79 (81%), Positives = 70/79 (88%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQ +K + PKIHKIRITLTSRKVQSLEKVCSEL+ERAKSK LRVKGPVR+PTK Sbjct: 1 MSFQKPEKDFG-EGPKIHKIRITLTSRKVQSLEKVCSELLERAKSKHLRVKGPVRLPTKT 59 Query: 332 LKISTRKTPCGEGSKTWDM 388 LK++TRKTPCGEGSKTWDM Sbjct: 60 LKVTTRKTPCGEGSKTWDM 78 >XP_009158988.1 40S ribosomal protein S20 [Exophiala dermatitidis NIH/UT8656] EHY58527.1 40S ribosomal protein S20 [Exophiala dermatitidis NIH/UT8656] Length = 116 Score = 129 bits (324), Expect = 2e-36 Identities = 64/79 (81%), Positives = 70/79 (88%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQ +K + PKIHKIRITLTSRKVQSLEKVCSEL+ERAKSK LRVKGPVR+PTK Sbjct: 1 MSFQKPEKDFG-EGPKIHKIRITLTSRKVQSLEKVCSELLERAKSKNLRVKGPVRLPTKT 59 Query: 332 LKISTRKTPCGEGSKTWDM 388 LK++TRKTPCGEGSKTWDM Sbjct: 60 LKVTTRKTPCGEGSKTWDM 78 >KUI60172.1 40S ribosomal protein S20 [Valsa mali var. pyri] KUI66139.1 40S ribosomal protein S20 [Valsa mali] Length = 116 Score = 128 bits (322), Expect = 5e-36 Identities = 63/78 (80%), Positives = 70/78 (89%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MS+Q +KG +APK HKIRI+LTSRKVQSLEKVCSELIERAK K+LRVKGPVR+PTK Sbjct: 1 MSYQKPEKG-EFEAPKTHKIRISLTSRKVQSLEKVCSELIERAKGKDLRVKGPVRLPTKT 59 Query: 332 LKISTRKTPCGEGSKTWD 385 LKI+TRKTPCGEGSKTWD Sbjct: 60 LKITTRKTPCGEGSKTWD 77 >XP_016257645.1 40S ribosomal protein S20 [Exophiala oligosperma] KIW37429.1 40S ribosomal protein S20 [Exophiala oligosperma] Length = 116 Score = 128 bits (321), Expect = 7e-36 Identities = 63/79 (79%), Positives = 70/79 (88%) Frame = +2 Query: 152 MSFQDAKKGGSLDAPKIHKIRITLTSRKVQSLEKVCSELIERAKSKELRVKGPVRMPTKN 331 MSFQ +K + PKIHKIRITLTSRKVQSLEKVC+EL+ERAKSK LRVKGPVR+PTK Sbjct: 1 MSFQKPEKDFG-EGPKIHKIRITLTSRKVQSLEKVCTELLERAKSKHLRVKGPVRLPTKT 59 Query: 332 LKISTRKTPCGEGSKTWDM 388 LK++TRKTPCGEGSKTWDM Sbjct: 60 LKVTTRKTPCGEGSKTWDM 78