BLASTX nr result
ID: Phellodendron21_contig00037386
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037386 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007415866.1 hypothetical protein MELLADRAFT_50279 [Melampsora... 61 1e-08 >XP_007415866.1 hypothetical protein MELLADRAFT_50279 [Melampsora larici-populina 98AG31] EGG00792.1 hypothetical protein MELLADRAFT_50279 [Melampsora larici-populina 98AG31] Length = 236 Score = 60.8 bits (146), Expect = 1e-08 Identities = 33/82 (40%), Positives = 48/82 (58%), Gaps = 5/82 (6%) Frame = +2 Query: 2 GFTNLDGLHLETPHLSSLELNELRPTFSLAHLKLLQLNPQAETYDHFLNDFESQEAQSSF 181 G + LDG+HLETP+LS+LELNELR F+ ++L L QL+PQ ++Y + D + +F Sbjct: 142 GLSGLDGIHLETPNLSALELNELRSVFNKSNLNLFQLHPQYDSYSQY--DSSQTQLDLNF 199 Query: 182 QADDT-----FARASSTLTHPS 232 D + ST+ H S Sbjct: 200 NHHDNRDLTPMDLSQSTMNHSS 221