BLASTX nr result
ID: Phellodendron21_contig00037311
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037311 (297 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO58804.1 hypothetical protein CISIN_1g0393781mg, partial [Citr... 72 5e-13 XP_006432651.1 hypothetical protein CICLE_v10000690mg [Citrus cl... 68 3e-11 >KDO58804.1 hypothetical protein CISIN_1g0393781mg, partial [Citrus sinensis] Length = 305 Score = 72.4 bits (176), Expect = 5e-13 Identities = 42/67 (62%), Positives = 48/67 (71%), Gaps = 11/67 (16%) Frame = +3 Query: 9 SSSSSTMGGEMKDTTFLSEPTNNN---QQIEG----KKNKHKHKDFEAEE----QNELNL 155 SS +S MGG+MKD T LSEPTNNN QQIE K K+KHK+ EAEE QNELNL Sbjct: 17 SSFNSAMGGKMKDATLLSEPTNNNATTQQIESNKKKKNKKNKHKEIEAEEEEEQQNELNL 76 Query: 156 KRKLESV 176 KRKLE++ Sbjct: 77 KRKLEAI 83 >XP_006432651.1 hypothetical protein CICLE_v10000690mg [Citrus clementina] XP_006471460.1 PREDICTED: DEAD-box ATP-dependent RNA helicase 5 [Citrus sinensis] ESR45891.1 hypothetical protein CICLE_v10000690mg [Citrus clementina] Length = 580 Score = 68.2 bits (165), Expect = 3e-11 Identities = 39/61 (63%), Positives = 44/61 (72%), Gaps = 11/61 (18%) Frame = +3 Query: 27 MGGEMKDTTFLSEPTNNN---QQIEG----KKNKHKHKDFEAEE----QNELNLKRKLES 173 MGG+MKD T LSEPTNNN QQIE K K+KHK+ EAEE QNELNLKRKLE+ Sbjct: 1 MGGKMKDATLLSEPTNNNATTQQIESNKKKKNKKNKHKEIEAEEEEEQQNELNLKRKLEA 60 Query: 174 V 176 + Sbjct: 61 I 61