BLASTX nr result
ID: Phellodendron21_contig00037263
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037263 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AIG15449.1 farnesyl diphosphate synthase [Azadirachta indica] 66 1e-10 CDP13684.1 unnamed protein product [Coffea canephora] 64 1e-09 AOV62781.1 farnesyl diphosphate synthase [Morus alba] 63 2e-09 XP_010103952.1 Farnesyl pyrophosphate synthase 1 [Morus notabili... 63 2e-09 XP_004149409.1 PREDICTED: farnesyl pyrophosphate synthase 1-like... 63 2e-09 XP_010252841.1 PREDICTED: farnesyl pyrophosphate synthase 1-like... 63 2e-09 AFW98445.1 farnesyl diphosphate synthase [Leibnitzia anandria] 63 2e-09 ADO95193.1 farnesyl diphosphate synthase [Catharanthus roseus] 63 2e-09 XP_006452655.1 hypothetical protein CICLE_v10008832mg [Citrus cl... 62 3e-09 GAV84877.1 polyprenyl_synt domain-containing protein [Cephalotus... 62 3e-09 ANA11766.1 farnesyl diphosphate synthase [Camellia sinensis] 62 3e-09 AAD45122.1 farnesyl pyrophosphate synthase, partial [Xanthoceras... 60 3e-09 XP_006452656.1 hypothetical protein CICLE_v10008832mg [Citrus cl... 62 4e-09 AAK68152.1 farnesyldiphosphate synthase [Citrus x microcarpa] 62 4e-09 OMO64666.1 Polyprenyl synthetase [Corchorus olitorius] 62 4e-09 AMN82836.1 farnesyl pyrophosphate synthase 1 [Ricinus communis] 62 4e-09 XP_011005729.1 PREDICTED: farnesyl pyrophosphate synthase 1 [Pop... 62 4e-09 AIU80188.1 farnesyl pyrophosphate synthase [Chlorophytum borivil... 62 4e-09 ACY80695.1 farnesyl pyrophosphate synthase [Cyclocarya paliurus] 62 4e-09 XP_006452657.1 hypothetical protein CICLE_v10008832mg [Citrus cl... 62 4e-09 >AIG15449.1 farnesyl diphosphate synthase [Azadirachta indica] Length = 342 Score = 66.2 bits (160), Expect = 1e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 ERESYEKL KSIE HPSKAVQAVLKSFL+KIYKRQK Sbjct: 307 ERESYEKLTKSIEAHPSKAVQAVLKSFLAKIYKRQK 342 >CDP13684.1 unnamed protein product [Coffea canephora] Length = 342 Score = 63.5 bits (153), Expect = 1e-09 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 ER+SYEKL K IE HPSKAVQAVLKSFLSKIYKRQK Sbjct: 307 ERKSYEKLNKGIEAHPSKAVQAVLKSFLSKIYKRQK 342 >AOV62781.1 farnesyl diphosphate synthase [Morus alba] Length = 342 Score = 63.2 bits (152), Expect = 2e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E SY+KLIKSIE HPSKAVQAVLKSFL+KIYKRQK Sbjct: 307 ENNSYQKLIKSIEAHPSKAVQAVLKSFLAKIYKRQK 342 >XP_010103952.1 Farnesyl pyrophosphate synthase 1 [Morus notabilis] EXB97655.1 Farnesyl pyrophosphate synthase 1 [Morus notabilis] Length = 342 Score = 63.2 bits (152), Expect = 2e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E SY+KLIKSIE HPSKAVQAVLKSFL+KIYKRQK Sbjct: 307 ENNSYQKLIKSIEAHPSKAVQAVLKSFLAKIYKRQK 342 >XP_004149409.1 PREDICTED: farnesyl pyrophosphate synthase 1-like [Cucumis sativus] KGN44386.1 hypothetical protein Csa_7G278210 [Cucumis sativus] Length = 342 Score = 63.2 bits (152), Expect = 2e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 ER+SYEKL+KSIE HPS AVQAVLKSFL+KIYKRQK Sbjct: 307 ERKSYEKLLKSIEVHPSDAVQAVLKSFLAKIYKRQK 342 >XP_010252841.1 PREDICTED: farnesyl pyrophosphate synthase 1-like [Nelumbo nucifera] Length = 349 Score = 63.2 bits (152), Expect = 2e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E+ESY+KLI SI+DHPSKAVQAVL+SFL KIYKRQK Sbjct: 314 EKESYKKLISSIKDHPSKAVQAVLESFLEKIYKRQK 349 >AFW98445.1 farnesyl diphosphate synthase [Leibnitzia anandria] Length = 342 Score = 62.8 bits (151), Expect = 2e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E++SYEKLI SIE HPSKAVQAVLKSFL KIYKRQK Sbjct: 307 EKKSYEKLITSIEAHPSKAVQAVLKSFLGKIYKRQK 342 >ADO95193.1 farnesyl diphosphate synthase [Catharanthus roseus] Length = 345 Score = 62.8 bits (151), Expect = 2e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 ER+SYEKL SIE HPSKAVQAVLKSFL+KIYKRQK Sbjct: 310 ERKSYEKLTSSIEAHPSKAVQAVLKSFLAKIYKRQK 345 >XP_006452655.1 hypothetical protein CICLE_v10008832mg [Citrus clementina] ESR65895.1 hypothetical protein CICLE_v10008832mg [Citrus clementina] KDO59204.1 hypothetical protein CISIN_1g019339mg [Citrus sinensis] Length = 247 Score = 62.0 bits (149), Expect = 3e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E+ESYEKL KSIE HP+K VQAVLKSFL+KIYKRQK Sbjct: 212 EKESYEKLTKSIEAHPTKEVQAVLKSFLAKIYKRQK 247 >GAV84877.1 polyprenyl_synt domain-containing protein [Cephalotus follicularis] Length = 342 Score = 62.4 bits (150), Expect = 3e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E +SYEKLI SIE HPSKAVQAVLKSFL+KIYKRQK Sbjct: 307 ESKSYEKLISSIEAHPSKAVQAVLKSFLAKIYKRQK 342 >ANA11766.1 farnesyl diphosphate synthase [Camellia sinensis] Length = 342 Score = 62.4 bits (150), Expect = 3e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E +SYEKLI SIE HPSKAVQAVLKSFL+KIYKRQK Sbjct: 307 ESKSYEKLINSIEAHPSKAVQAVLKSFLAKIYKRQK 342 >AAD45122.1 farnesyl pyrophosphate synthase, partial [Xanthoceras sorbifolium] Length = 148 Score = 60.1 bits (144), Expect = 3e-09 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E ESYEKLIKSIE HPSKAVQAVLKSF KIYK QK Sbjct: 113 ESESYEKLIKSIEAHPSKAVQAVLKSFSGKIYKWQK 148 >XP_006452656.1 hypothetical protein CICLE_v10008832mg [Citrus clementina] ESR65896.1 hypothetical protein CICLE_v10008832mg [Citrus clementina] Length = 337 Score = 62.0 bits (149), Expect = 4e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E+ESYEKL KSIE HP+K VQAVLKSFL+KIYKRQK Sbjct: 302 EKESYEKLTKSIEAHPTKEVQAVLKSFLAKIYKRQK 337 >AAK68152.1 farnesyldiphosphate synthase [Citrus x microcarpa] Length = 341 Score = 62.0 bits (149), Expect = 4e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E+ESYEKL KSIE HP+K VQAVLKSFL+KIYKRQK Sbjct: 306 EKESYEKLTKSIEAHPTKEVQAVLKSFLAKIYKRQK 341 >OMO64666.1 Polyprenyl synthetase [Corchorus olitorius] Length = 342 Score = 62.0 bits (149), Expect = 4e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E +SYEKL+ SIE HPSKAVQAVLKSFL KIYKRQK Sbjct: 307 ESKSYEKLVTSIESHPSKAVQAVLKSFLGKIYKRQK 342 >AMN82836.1 farnesyl pyrophosphate synthase 1 [Ricinus communis] Length = 342 Score = 62.0 bits (149), Expect = 4e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E +SYEKL+ SIE HPSKAVQAVLKSFL+KIYKRQK Sbjct: 307 ENKSYEKLVTSIEAHPSKAVQAVLKSFLAKIYKRQK 342 >XP_011005729.1 PREDICTED: farnesyl pyrophosphate synthase 1 [Populus euphratica] Length = 342 Score = 62.0 bits (149), Expect = 4e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E +SYEKLI SIE HPSKAVQAVLKSFL+KIYKRQK Sbjct: 307 ESKSYEKLIASIEAHPSKAVQAVLKSFLAKIYKRQK 342 >AIU80188.1 farnesyl pyrophosphate synthase [Chlorophytum borivilianum] Length = 342 Score = 62.0 bits (149), Expect = 4e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E +SYEKLI SIE HPSKAVQAVLKSFL+KIYKRQK Sbjct: 307 ESKSYEKLITSIEAHPSKAVQAVLKSFLAKIYKRQK 342 >ACY80695.1 farnesyl pyrophosphate synthase [Cyclocarya paliurus] Length = 342 Score = 62.0 bits (149), Expect = 4e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E +SYE L+KSIE HPSKAVQAVLKSFL+KIYKRQK Sbjct: 307 ESKSYENLVKSIEAHPSKAVQAVLKSFLAKIYKRQK 342 >XP_006452657.1 hypothetical protein CICLE_v10008832mg [Citrus clementina] XP_006474825.1 PREDICTED: farnesyl pyrophosphate synthase 1 [Citrus sinensis] ESR65897.1 hypothetical protein CICLE_v10008832mg [Citrus clementina] KDO59203.1 hypothetical protein CISIN_1g019339mg [Citrus sinensis] Length = 342 Score = 62.0 bits (149), Expect = 4e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 20 ERESYEKLIKSIEDHPSKAVQAVLKSFLSKIYKRQK 127 E+ESYEKL KSIE HP+K VQAVLKSFL+KIYKRQK Sbjct: 307 EKESYEKLTKSIEAHPTKEVQAVLKSFLAKIYKRQK 342