BLASTX nr result
ID: Phellodendron21_contig00037134
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037134 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAV91139.1 hypothetical protein PTTG_08669 [Puccinia triticina 1... 52 2e-06 >OAV91139.1 hypothetical protein PTTG_08669 [Puccinia triticina 1-1 BBBD Race 1] Length = 113 Score = 52.4 bits (124), Expect = 2e-06 Identities = 28/60 (46%), Positives = 39/60 (65%) Frame = +2 Query: 2 AIGLWLSVRWFVAELKRVNRINEPIPIDSEIKVHGKLNQNWHITQPEAAGSTNLSKAKAD 181 AI LW+SVRWFVAEL R+N +N+P+ I S + L+ N QP + STN+ K K++ Sbjct: 61 AICLWISVRWFVAELARMNHLNKPVEISSAL-----LSTN--DPQPSSESSTNIDKLKSN 113