BLASTX nr result
ID: Phellodendron21_contig00037057
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037057 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNF02912.1 hypothetical protein PSTG_03859 [Puccinia striiformis... 86 2e-17 OAV99110.1 hypothetical protein PTTG_02357 [Puccinia triticina 1... 84 2e-16 KNZ56542.1 hypothetical protein VP01_237g9 [Puccinia sorghi] 78 2e-14 XP_003335729.2 hypothetical protein PGTG_17167 [Puccinia gramini... 75 2e-13 >KNF02912.1 hypothetical protein PSTG_03859 [Puccinia striiformis f. sp. tritici PST-78] Length = 536 Score = 86.3 bits (212), Expect = 2e-17 Identities = 36/58 (62%), Positives = 43/58 (74%) Frame = -2 Query: 331 LLSFHFILPPLLTILQWPNVLTVFWSSIVGLSCLPVFWIICETWIIFKDQLPPNSVWR 158 LLSFH+ILP +LTIL WP L +FW SIV LS LPV W+ CE W++FKD P S+WR Sbjct: 477 LLSFHYILPSVLTILDWPRHLNLFWISIVSLSSLPVLWLACEAWVVFKDCKSPQSLWR 534 >OAV99110.1 hypothetical protein PTTG_02357 [Puccinia triticina 1-1 BBBD Race 1] Length = 571 Score = 83.6 bits (205), Expect = 2e-16 Identities = 34/58 (58%), Positives = 42/58 (72%) Frame = -2 Query: 331 LLSFHFILPPLLTILQWPNVLTVFWSSIVGLSCLPVFWIICETWIIFKDQLPPNSVWR 158 LLSFH++LP +L IL WP L +FW S+V LS LPV W+ CE W+IFKD P S+WR Sbjct: 512 LLSFHYLLPSVLVILDWPRNLNLFWISVVSLSSLPVLWLACEAWVIFKDCKSPQSLWR 569 >KNZ56542.1 hypothetical protein VP01_237g9 [Puccinia sorghi] Length = 580 Score = 77.8 bits (190), Expect = 2e-14 Identities = 32/56 (57%), Positives = 40/56 (71%) Frame = -2 Query: 331 LLSFHFILPPLLTILQWPNVLTVFWSSIVGLSCLPVFWIICETWIIFKDQLPPNSV 164 LLS H++LP +L IL WP L +FW S+V LS LP+ W+ CE W+IFKD PNSV Sbjct: 525 LLSLHYVLPSVLVILDWPRHLNLFWISVVSLSSLPLLWLACEAWVIFKDCKSPNSV 580 >XP_003335729.2 hypothetical protein PGTG_17167 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] EFP91310.2 hypothetical protein PGTG_17167 [Puccinia graminis f. sp. tritici CRL 75-36-700-3] Length = 567 Score = 74.7 bits (182), Expect = 2e-13 Identities = 31/56 (55%), Positives = 38/56 (67%) Frame = -2 Query: 331 LLSFHFILPPLLTILQWPNVLTVFWSSIVGLSCLPVFWIICETWIIFKDQLPPNSV 164 LL FH++LP +L IL WP L +FW S+V S LPV W+ CE W+IFKD P SV Sbjct: 510 LLLFHYLLPSVLVILDWPRNLNLFWISVVSFSSLPVLWLACEAWVIFKDCKSPQSV 565