BLASTX nr result
ID: Phellodendron21_contig00037035
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00037035 (352 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAO89238.1 hypothetical protein AXX17_ATUG02790 (mitochondrion) ... 74 1e-15 >OAO89238.1 hypothetical protein AXX17_ATUG02790 (mitochondrion) [Arabidopsis thaliana] Length = 53 Score = 74.3 bits (181), Expect = 1e-15 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = -1 Query: 253 VSIPTAVLSTNASRAGLTNLTLPLRGPCHSWVLRFSVIYEG*ARFG 116 V IPTAVLSTNASRAGLTNLTL +RGPCHSWVL FSVI EG AR G Sbjct: 2 VPIPTAVLSTNASRAGLTNLTLKVRGPCHSWVLCFSVIDEG-ARLG 46