BLASTX nr result
ID: Phellodendron21_contig00036855
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036855 (306 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006428797.1 hypothetical protein CICLE_v10011672mg [Citrus cl... 57 3e-07 >XP_006428797.1 hypothetical protein CICLE_v10011672mg [Citrus clementina] XP_006481447.1 PREDICTED: uncharacterized protein LOC102630963 [Citrus sinensis] ESR42037.1 hypothetical protein CICLE_v10011672mg [Citrus clementina] Length = 462 Score = 56.6 bits (135), Expect = 3e-07 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -3 Query: 136 MDLKSLKFKILHXXXXXXXXXXXVMIFSALSIVPLLQILFGNDPV 2 MDLK+LKFKILH MI SALSIVPLLQILFG+DPV Sbjct: 1 MDLKTLKFKILHGSLARRVLLRSFMIVSALSIVPLLQILFGSDPV 45