BLASTX nr result
ID: Phellodendron21_contig00036732
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036732 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007411373.1 hypothetical protein MELLADRAFT_78105 [Melampsora... 59 1e-07 >XP_007411373.1 hypothetical protein MELLADRAFT_78105 [Melampsora larici-populina 98AG31] EGG05451.1 hypothetical protein MELLADRAFT_78105 [Melampsora larici-populina 98AG31] Length = 286 Score = 58.5 bits (140), Expect = 1e-07 Identities = 39/97 (40%), Positives = 53/97 (54%), Gaps = 4/97 (4%) Frame = -1 Query: 349 SGSQHQAELEDLPSYSPPTSQPNVLV--EPNAXXXXXXXXXXXXTPQRRDSIMPDDDLLE 176 + Q LE+LP+YSP T+QPN L+ E + + QRRD+ MPD+DL+ Sbjct: 192 ANGQRTTVLEELPTYSP-TTQPNELIPIETTSEIPTLDHVDSSRSQQRRDT-MPDEDLIL 249 Query: 175 AAQTAIEEEEHENQQRLAQTA--APSTHVDDPPSYQP 71 AAQTA+E E E L + P+ H D PP Y+P Sbjct: 250 AAQTALEVERIEQDLVLESSTNLNPTHHDDHPPLYEP 286