BLASTX nr result
ID: Phellodendron21_contig00036671
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036671 (431 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO57369.1 hypothetical protein CISIN_1g0148771mg [Citrus sinensis] 61 4e-08 >KDO57369.1 hypothetical protein CISIN_1g0148771mg [Citrus sinensis] Length = 374 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -2 Query: 430 GLNTKEFDMHVIIEVSFWLCLSFCSVQKFLKVSMLHTCCHY 308 GL+TKEFDMHVIIEVS WL L C +QKF+K+S+L C Y Sbjct: 316 GLDTKEFDMHVIIEVSLWLSLLVCFLQKFMKISVLRINCQY 356