BLASTX nr result
ID: Phellodendron21_contig00036650
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036650 (391 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006490148.1 PREDICTED: DNA-directed RNA polymerase III subuni... 60 3e-08 XP_006421620.1 hypothetical protein CICLE_v10005426mg [Citrus cl... 60 3e-08 >XP_006490148.1 PREDICTED: DNA-directed RNA polymerase III subunit RPC4 isoform X1 [Citrus sinensis] Length = 324 Score = 60.5 bits (145), Expect = 3e-08 Identities = 29/44 (65%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = -3 Query: 386 VKYAPKAPPLSRRPKVTAPT--PRSDSKNEDSEAQA*KLMREFN 261 V++APKAPP SR+PKVTAPT PR +SK+ED EA+A +L+R+FN Sbjct: 15 VRFAPKAPPPSRQPKVTAPTPVPRPESKHEDPEAEAQRLLRQFN 58 >XP_006421620.1 hypothetical protein CICLE_v10005426mg [Citrus clementina] ESR34860.1 hypothetical protein CICLE_v10005426mg [Citrus clementina] Length = 324 Score = 60.5 bits (145), Expect = 3e-08 Identities = 29/44 (65%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = -3 Query: 386 VKYAPKAPPLSRRPKVTAPT--PRSDSKNEDSEAQA*KLMREFN 261 V++APKAPP SR+PKVTAPT PR +SK+ED EA+A +L+R+FN Sbjct: 15 VRFAPKAPPPSRQPKVTAPTPVPRPESKHEDPEAEAQRLLRQFN 58