BLASTX nr result
ID: Phellodendron21_contig00036624
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036624 (314 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007417351.1 hypothetical protein MELLADRAFT_68653 [Melampsora... 57 2e-07 >XP_007417351.1 hypothetical protein MELLADRAFT_68653 [Melampsora larici-populina 98AG31] EGF99335.1 hypothetical protein MELLADRAFT_68653 [Melampsora larici-populina 98AG31] Length = 218 Score = 56.6 bits (135), Expect = 2e-07 Identities = 34/83 (40%), Positives = 43/83 (51%) Frame = -1 Query: 311 RMTDSDSSMKLDPPRSPHPKLGPRKDGMRIDNDNDTHDSRPGSLKRPHXXXXXSEAAPNL 132 R + + M LD P PKLGPRKDGMRID+D S+ SLKRP N Sbjct: 90 RGMEVNDPMDLDTSTFPQPKLGPRKDGMRIDHDESQSQSQFNSLKRPQ--KSSHSTNNNE 147 Query: 131 INNRSNSHKRKKVQDPTPAITSS 63 I S K++K+Q+ P +SS Sbjct: 148 IIETQPSLKKRKIQESQPFTSSS 170