BLASTX nr result
ID: Phellodendron21_contig00036545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036545 (297 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007416372.1 hypothetical protein MELLADRAFT_73205 [Melampsora... 58 3e-08 >XP_007416372.1 hypothetical protein MELLADRAFT_73205 [Melampsora larici-populina 98AG31] EGG00353.1 hypothetical protein MELLADRAFT_73205 [Melampsora larici-populina 98AG31] Length = 167 Score = 57.8 bits (138), Expect = 3e-08 Identities = 26/46 (56%), Positives = 38/46 (82%) Frame = +2 Query: 2 RNGIIQVEDPRRTAMESGRFESIDDKMNKEIEDQDLKDEEEALAEM 139 RNG+I+VEDPRR A+E+GRF I+D +NKE+E ++ K+E+ AL E+ Sbjct: 102 RNGVIKVEDPRRKAVETGRFTVIEDTVNKELELEEEKEEQLALKEL 147