BLASTX nr result
ID: Phellodendron21_contig00036478
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036478 (391 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONI21154.1 hypothetical protein PRUPE_2G050800 [Prunus persica] 55 1e-06 XP_008231715.1 PREDICTED: probable aldo-keto reductase 2 [Prunus... 54 5e-06 >ONI21154.1 hypothetical protein PRUPE_2G050800 [Prunus persica] Length = 217 Score = 55.1 bits (131), Expect = 1e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -3 Query: 98 ILFCVLWKIGELKKLVEEGKIKYIGLSEASAS 3 +L+ V++K+GELKKLVEEGK+KYIGLSEASAS Sbjct: 6 VLYHVIYKVGELKKLVEEGKVKYIGLSEASAS 37 >XP_008231715.1 PREDICTED: probable aldo-keto reductase 2 [Prunus mume] Length = 212 Score = 53.5 bits (127), Expect = 5e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = -3 Query: 98 ILFCVLWKIGELKKLVEEGKIKYIGLSEASAS 3 +L+ V++K+GELKKLVEEGK++YIGLSEASAS Sbjct: 6 LLYHVIYKVGELKKLVEEGKVRYIGLSEASAS 37