BLASTX nr result
ID: Phellodendron21_contig00036455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036455 (371 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAO89183.1 hypothetical protein AXX17_ATUG03540 (mitochondrion) ... 67 1e-10 >OAO89183.1 hypothetical protein AXX17_ATUG03540 (mitochondrion) [Arabidopsis thaliana] Length = 776 Score = 67.4 bits (163), Expect = 1e-10 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +3 Query: 69 VTDQSGPRFPGSNAEGLSFRPDLCFAASPTASSDGPTYYLCMR 197 VTDQSGPRFP SNAEGLSFRPDLCFAASPTA S ++ +R Sbjct: 45 VTDQSGPRFPSSNAEGLSFRPDLCFAASPTARSHPSANHVGLR 87