BLASTX nr result
ID: Phellodendron21_contig00036415
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036415 (568 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010088878.1 DnaJ homolog subfamily C member 13 [Morus notabil... 61 2e-07 >XP_010088878.1 DnaJ homolog subfamily C member 13 [Morus notabilis] EXB37075.1 DnaJ homolog subfamily C member 13 [Morus notabilis] Length = 2650 Score = 60.8 bits (146), Expect = 2e-07 Identities = 41/97 (42%), Positives = 55/97 (56%), Gaps = 3/97 (3%) Frame = +1 Query: 280 KLGANQSHQSHRNPAAATRSNNDAGVNFWSFLRQQHAPRHHTLHYLSHID--YVNRVSPN 453 +LGANQS +SHR P + AGV W FLR +APR HTLHYL H++ V+R + + Sbjct: 5 ELGANQS-RSHRAPPSG-----QAGVGLWLFLRPNNAPRAHTLHYLPHVESSLVSRHTVD 58 Query: 454 PRP-SQPSPKMDSANTSSNSAXXXXXXXXXXXYLARY 561 P + S M+S++ SSNS Y+ARY Sbjct: 59 QAPLASSSTSMESSSASSNS---NFAPLEEPEYVARY 92