BLASTX nr result
ID: Phellodendron21_contig00036414
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036414 (394 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010088878.1 DnaJ homolog subfamily C member 13 [Morus notabil... 57 5e-07 >XP_010088878.1 DnaJ homolog subfamily C member 13 [Morus notabilis] EXB37075.1 DnaJ homolog subfamily C member 13 [Morus notabilis] Length = 2650 Score = 57.4 bits (137), Expect = 5e-07 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 3/72 (4%) Frame = +2 Query: 140 KLGANQSHQSHRNPAAATRPNNDAGVNFWFFLRQHRPPRHHTLHYLTHIDS--VNHVSPD 313 +LGANQS +SHR P P+ AGV W FLR + PR HTLHYL H++S V+ + D Sbjct: 5 ELGANQS-RSHRAP-----PSGQAGVGLWLFLRPNNAPRAHTLHYLPHVESSLVSRHTVD 58 Query: 314 PRP-SQPSTKMD 346 P + ST M+ Sbjct: 59 QAPLASSSTSME 70