BLASTX nr result
ID: Phellodendron21_contig00036413
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036413 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006444815.1 hypothetical protein CICLE_v10019982mg [Citrus cl... 70 1e-11 >XP_006444815.1 hypothetical protein CICLE_v10019982mg [Citrus clementina] ESR58055.1 hypothetical protein CICLE_v10019982mg [Citrus clementina] Length = 335 Score = 69.7 bits (169), Expect = 1e-11 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 370 AHGSPDSRRASVEEGQMPFGSGEMLRYIFMLYFVVVYCVKVN 245 A GSPDSRRASVEEGQMPFGS E YI M YF+VVYC+K+N Sbjct: 294 AQGSPDSRRASVEEGQMPFGSSESFGYILMSYFLVVYCMKLN 335