BLASTX nr result
ID: Phellodendron21_contig00036193
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036193 (418 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007417630.1 hypothetical protein MELLADRAFT_94890 [Melampsora... 73 3e-12 XP_007418502.1 hypothetical protein MELLADRAFT_96074 [Melampsora... 66 5e-10 XP_007417629.1 hypothetical protein MELLADRAFT_94889 [Melampsora... 62 1e-08 XP_007416185.1 hypothetical protein MELLADRAFT_111786 [Melampsor... 57 7e-07 XP_007409567.1 hypothetical protein MELLADRAFT_62899 [Melampsora... 54 9e-06 >XP_007417630.1 hypothetical protein MELLADRAFT_94890 [Melampsora larici-populina 98AG31] EGF99061.1 hypothetical protein MELLADRAFT_94890 [Melampsora larici-populina 98AG31] Length = 498 Score = 72.8 bits (177), Expect = 3e-12 Identities = 39/83 (46%), Positives = 49/83 (59%), Gaps = 2/83 (2%) Frame = +1 Query: 172 KRGLSDSLLQPIQGKAGGSGFPTGLVNGIPDYNAC-QPDGRIPSSQDGDASFTQGINSLN 348 KR + +LL G G F GL+ G+PDYNAC +PDG IP ++ GDA FTQG + Sbjct: 71 KRDVFGNLLPTGSGNHGQESFLHGLLLGVPDYNACGRPDGPIPPTRPGDAPFTQGRFAYE 130 Query: 349 NAIVCPKG-TNGRRGVVFGIPCT 414 AI CP G N G+V +PCT Sbjct: 131 KAITCPNGIRNSPNGIVLLVPCT 153 >XP_007418502.1 hypothetical protein MELLADRAFT_96074 [Melampsora larici-populina 98AG31] EGF98232.1 hypothetical protein MELLADRAFT_96074 [Melampsora larici-populina 98AG31] Length = 477 Score = 66.2 bits (160), Expect = 5e-10 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 2/70 (2%) Frame = +1 Query: 214 KAGGSGFPTGLVNGIPDYNAC-QPDGRIPSSQDGDASFTQGINSLNNAIVCPKG-TNGRR 387 K F G++ G+P+Y+ C PDG IPSS GDA F+QG NS AI CP+G N Sbjct: 46 KVRSPNFLQGMLYGVPNYDTCASPDGPIPSSMPGDAPFSQGQNSYKRAITCPRGIQNLSG 105 Query: 388 GVVFGIPCTA 417 GVV +PCT+ Sbjct: 106 GVVLLVPCTS 115 >XP_007417629.1 hypothetical protein MELLADRAFT_94889 [Melampsora larici-populina 98AG31] EGF99060.1 hypothetical protein MELLADRAFT_94889 [Melampsora larici-populina 98AG31] Length = 481 Score = 62.0 bits (149), Expect = 1e-08 Identities = 34/80 (42%), Positives = 43/80 (53%), Gaps = 2/80 (2%) Frame = +1 Query: 181 LSDSLLQPIQGKAGGSGFPTGLVNGIPDYNACQP-DGRIPSSQDGDASFTQGINSLNNAI 357 L+ +LL G F G +NG+P YN C P DG IP S GDA FTQG + I Sbjct: 53 LTGTLLANGNDDHGNESFLHGTLNGVPPYNPCGPSDGPIPPSAPGDAPFTQGRFAYEKKI 112 Query: 358 VCPKG-TNGRRGVVFGIPCT 414 CP G N +G++ +PCT Sbjct: 113 SCPHGIRNSPKGILLMVPCT 132 >XP_007416185.1 hypothetical protein MELLADRAFT_111786 [Melampsora larici-populina 98AG31] EGG00538.1 hypothetical protein MELLADRAFT_111786 [Melampsora larici-populina 98AG31] Length = 340 Score = 57.0 bits (136), Expect = 7e-07 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 2/59 (3%) Frame = +1 Query: 247 VNGIPDYNACQP-DGRIPSSQDGDASFTQGINSLNNAIVCPKGTNGR-RGVVFGIPCTA 417 +N +P Y+ C P +G IPSS+ GDA F+QG S +AI CP+G RG+V +PCT+ Sbjct: 35 LNVVPKYDTCAPPNGPIPSSKPGDAPFSQGQKSYESAIHCPRGIRDMPRGIVLMVPCTS 93 >XP_007409567.1 hypothetical protein MELLADRAFT_62899 [Melampsora larici-populina 98AG31] EGG07125.1 hypothetical protein MELLADRAFT_62899 [Melampsora larici-populina 98AG31] Length = 349 Score = 53.9 bits (128), Expect = 9e-06 Identities = 26/45 (57%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +1 Query: 241 GLVNGIPDYNAC-QPDGRIPSSQDGDASFTQGINSLNNAIVCPKG 372 GL+NG+P Y+ C PDG IPSS+ DA F+QG NS AI CP G Sbjct: 61 GLLNGVPYYDPCGSPDGPIPSSKPNDAPFSQGENSYQRAIHCPLG 105