BLASTX nr result
ID: Phellodendron21_contig00036175
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036175 (291 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019054600.1 PREDICTED: probable pre-mRNA-splicing factor ATP-... 50 1e-06 >XP_019054600.1 PREDICTED: probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 isoform X2 [Nelumbo nucifera] Length = 561 Score = 49.7 bits (117), Expect(2) = 1e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -2 Query: 104 YASADLPWASSVITNYSFFSTQLLCPA 24 YASADLPWASSVIT SFFSTQLLCPA Sbjct: 536 YASADLPWASSVIT-ISFFSTQLLCPA 561 Score = 30.0 bits (66), Expect(2) = 1e-06 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -1 Query: 201 PRLACTIGF*VLMQIVAVSQYSHMKQLVSSRL 106 P C+ + +++VSQYS MKQ+VSSRL Sbjct: 504 PEFNCSNEILSISAMLSVSQYSLMKQMVSSRL 535