BLASTX nr result
ID: Phellodendron21_contig00036129
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036129 (312 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007408167.1 hypothetical protein MELLADRAFT_77369 [Melampsora... 63 2e-09 >XP_007408167.1 hypothetical protein MELLADRAFT_77369 [Melampsora larici-populina 98AG31] EGG08581.1 hypothetical protein MELLADRAFT_77369 [Melampsora larici-populina 98AG31] Length = 1027 Score = 63.2 bits (152), Expect = 2e-09 Identities = 43/97 (44%), Positives = 57/97 (58%), Gaps = 2/97 (2%) Frame = -1 Query: 312 AGRVYKRKASNSSLNGVSASAVKTENFSPYSMGFTHSASSSLSML--RRPPQSPTPTGPY 139 AGRVYKRKASNSSL G +A+K E++SP+S+GFT S SS+ ++L + QSPTP Y Sbjct: 940 AGRVYKRKASNSSLIG-GGTAMK-ESYSPHSVGFTPSTSSTFNLLNHHQQAQSPTPQPSY 997 Query: 138 XXXXXXXXXXXXQGLGSNSSGFPPRKTRRSTAWKAAS 28 + FP RKTRR+ A K ++ Sbjct: 998 ------------------ENTFPVRKTRRTNAMKPSN 1016