BLASTX nr result
ID: Phellodendron21_contig00036045
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00036045 (449 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_005649462.1 hypothetical protein COCSUDRAFT_62329 [Coccomyxa ... 60 1e-08 >XP_005649462.1 hypothetical protein COCSUDRAFT_62329 [Coccomyxa subellipsoidea C-169] EIE24918.1 hypothetical protein COCSUDRAFT_62329 [Coccomyxa subellipsoidea C-169] Length = 134 Score = 60.1 bits (144), Expect = 1e-08 Identities = 37/79 (46%), Positives = 45/79 (56%), Gaps = 5/79 (6%) Frame = -1 Query: 440 RSLMPGGGNDKKIVNFNKNSQVRKAKKLLPFDQKLMDAIPGKGKKAFNARN---EGDV-- 276 +S++ + K V NS+VRKAKKLLP+DQKL D PG+ K NARN +G Sbjct: 26 KSVVTEAKSVSKNVQRGLNSEVRKAKKLLPWDQKLFDTAPGRAKNMSNARNVPRKGGFGG 85 Query: 275 QGPYQKSSGKIPGARGLPP 219 G YQK S IP A G P Sbjct: 86 GGAYQKISKNIPSAAGTKP 104