BLASTX nr result
ID: Phellodendron21_contig00035969
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035969 (289 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO46393.1 hypothetical protein CISIN_1g022842mg [Citrus sinensis] 56 4e-07 XP_006432864.1 hypothetical protein CICLE_v10002053mg [Citrus cl... 56 4e-07 XP_006433003.1 hypothetical protein CICLE_v10003467mg [Citrus cl... 50 3e-06 >KDO46393.1 hypothetical protein CISIN_1g022842mg [Citrus sinensis] Length = 291 Score = 55.8 bits (133), Expect = 4e-07 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 98 QRKGCFWCSPKSVSKKKKLENSILSNDLDWG 6 QRKGCFWCSPK+ S+KK E+ IL +DLDWG Sbjct: 196 QRKGCFWCSPKNASQKKSRESPILGDDLDWG 226 >XP_006432864.1 hypothetical protein CICLE_v10002053mg [Citrus clementina] XP_006471626.1 PREDICTED: uncharacterized protein LOC102625701 [Citrus sinensis] ESR46104.1 hypothetical protein CICLE_v10002053mg [Citrus clementina] Length = 291 Score = 55.8 bits (133), Expect = 4e-07 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -3 Query: 98 QRKGCFWCSPKSVSKKKKLENSILSNDLDWG 6 QRKGCFWCSPK+ S+KK E+ IL +DLDWG Sbjct: 196 QRKGCFWCSPKNASQKKSRESPILGDDLDWG 226 >XP_006433003.1 hypothetical protein CICLE_v10003467mg [Citrus clementina] ESR46243.1 hypothetical protein CICLE_v10003467mg [Citrus clementina] Length = 82 Score = 50.4 bits (119), Expect = 3e-06 Identities = 24/39 (61%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -2 Query: 141 SEFMDGFAF-SAISAAKEGLFLVFSQECFKEKEIGKFNT 28 SEFMDGF F SA+S +++GLF +FS+ECF+EKE K N+ Sbjct: 43 SEFMDGFTFFSAVSTSEKGLFFMFSKECFEEKEQEKSNS 81