BLASTX nr result
ID: Phellodendron21_contig00035958
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035958 (321 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO41743.1 hypothetical protein CISIN_1g031684mg [Citrus sinensis] 52 7e-06 >KDO41743.1 hypothetical protein CISIN_1g031684mg [Citrus sinensis] Length = 155 Score = 51.6 bits (122), Expect = 7e-06 Identities = 22/31 (70%), Positives = 30/31 (96%) Frame = +2 Query: 2 EVYLRKQIMDSTEEMIEDMRRKADRVYKYMI 94 EVY+RKQI+++TEEMIE+M+ KA+RV+KYMI Sbjct: 114 EVYMRKQILNTTEEMIEEMKNKAERVHKYMI 144