BLASTX nr result
ID: Phellodendron21_contig00035774
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035774 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006436855.1 hypothetical protein CICLE_v10032864mg [Citrus cl... 56 2e-07 XP_008221191.1 PREDICTED: mediator of RNA polymerase II transcri... 55 6e-07 XP_007223516.1 hypothetical protein PRUPE_ppa011908mg [Prunus pe... 55 6e-07 XP_009334475.1 PREDICTED: mediator of RNA polymerase II transcri... 55 6e-07 XP_008387893.1 PREDICTED: mediator of RNA polymerase II transcri... 55 6e-07 CAN73869.1 hypothetical protein VITISV_001275 [Vitis vinifera] C... 54 2e-06 KVI06178.1 hypothetical protein Ccrd_015478 [Cynara cardunculus ... 53 2e-06 XP_002283991.2 PREDICTED: mediator of RNA polymerase II transcri... 54 3e-06 EOY22498.1 Uncharacterized protein TCM_014655 isoform 2, partial... 52 3e-06 EOY22499.1 Uncharacterized protein TCM_014655 isoform 3 [Theobro... 52 3e-06 XP_018824968.1 PREDICTED: mediator of RNA polymerase II transcri... 53 3e-06 XP_015580983.1 PREDICTED: mediator of RNA polymerase II transcri... 53 3e-06 CDP07896.1 unnamed protein product [Coffea canephora] 53 4e-06 XP_007037997.2 PREDICTED: mediator of RNA polymerase II transcri... 52 4e-06 XP_002511168.1 PREDICTED: mediator of RNA polymerase II transcri... 53 4e-06 XP_012090682.1 PREDICTED: mediator of RNA polymerase II transcri... 52 6e-06 XP_007037996.2 PREDICTED: mediator of RNA polymerase II transcri... 52 6e-06 XP_017604873.1 PREDICTED: mediator of RNA polymerase II transcri... 52 6e-06 XP_012467932.1 PREDICTED: mediator of RNA polymerase II transcri... 52 6e-06 EOY22497.1 Uncharacterized protein TCM_014655 isoform 1 [Theobro... 52 6e-06 >XP_006436855.1 hypothetical protein CICLE_v10032864mg [Citrus clementina] XP_006493212.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 [Citrus sinensis] ESR50095.1 hypothetical protein CICLE_v10032864mg [Citrus clementina] Length = 183 Score = 56.2 bits (134), Expect = 2e-07 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA+EGQKHLE++IEA+FQIL+SMNDELCN Sbjct: 19 ELAKEGQKHLEETIEAAFQILSSMNDELCN 48 >XP_008221191.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 [Prunus mume] XP_016647958.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 [Prunus mume] Length = 191 Score = 55.1 bits (131), Expect = 6e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EGQKHLE++IEA+FQIL+SMNDELCN Sbjct: 14 ELAMEGQKHLEETIEAAFQILSSMNDELCN 43 >XP_007223516.1 hypothetical protein PRUPE_ppa011908mg [Prunus persica] ONI32290.1 hypothetical protein PRUPE_1G358600 [Prunus persica] Length = 191 Score = 55.1 bits (131), Expect = 6e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EGQKHLE++IEA+FQIL+SMNDELCN Sbjct: 14 ELAMEGQKHLEETIEAAFQILSSMNDELCN 43 >XP_009334475.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 [Pyrus x bretschneideri] Length = 194 Score = 55.1 bits (131), Expect = 6e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EGQKHLE++IEA+FQIL+SMNDELCN Sbjct: 18 ELAMEGQKHLEETIEAAFQILSSMNDELCN 47 >XP_008387893.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 [Malus domestica] Length = 194 Score = 55.1 bits (131), Expect = 6e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EGQKHLE++IEA+FQIL+SMNDELCN Sbjct: 18 ELAMEGQKHLEETIEAAFQILSSMNDELCN 47 >CAN73869.1 hypothetical protein VITISV_001275 [Vitis vinifera] CBI15686.3 unnamed protein product, partial [Vitis vinifera] Length = 174 Score = 53.5 bits (127), Expect = 2e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EGQKHLE++IE++FQIL+SMNDELCN Sbjct: 11 ELALEGQKHLEETIESAFQILSSMNDELCN 40 >KVI06178.1 hypothetical protein Ccrd_015478 [Cynara cardunculus var. scolymus] Length = 174 Score = 53.1 bits (126), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EGQKHLE +IE++FQIL+SMNDELCN Sbjct: 17 ELAMEGQKHLEDTIESAFQILSSMNDELCN 46 >XP_002283991.2 PREDICTED: mediator of RNA polymerase II transcription subunit 30 [Vitis vinifera] Length = 212 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EGQKHLE++IE++FQIL+SMNDELCN Sbjct: 49 ELALEGQKHLEETIESAFQILSSMNDELCN 78 >EOY22498.1 Uncharacterized protein TCM_014655 isoform 2, partial [Theobroma cacao] Length = 142 Score = 52.4 bits (124), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EG KHLE++IEA+FQIL+SMNDELCN Sbjct: 21 ELAAEGLKHLEETIEAAFQILSSMNDELCN 50 >EOY22499.1 Uncharacterized protein TCM_014655 isoform 3 [Theobroma cacao] Length = 143 Score = 52.4 bits (124), Expect = 3e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EG KHLE++IEA+FQIL+SMNDELCN Sbjct: 21 ELAAEGLKHLEETIEAAFQILSSMNDELCN 50 >XP_018824968.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30-like [Juglans regia] Length = 198 Score = 53.1 bits (126), Expect = 3e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EGQKHLE++IE++FQIL+SMNDELCN Sbjct: 17 ELAIEGQKHLEETIESAFQILSSMNDELCN 46 >XP_015580983.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 isoform X2 [Ricinus communis] Length = 171 Score = 52.8 bits (125), Expect = 3e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EGQKHLE++I+A++QIL+SMNDELCN Sbjct: 17 ELAMEGQKHLEETIQAAYQILSSMNDELCN 46 >CDP07896.1 unnamed protein product [Coffea canephora] Length = 209 Score = 53.1 bits (126), Expect = 4e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EGQKHLE++IE++FQIL+SMNDELCN Sbjct: 20 ELAVEGQKHLEETIESAFQILSSMNDELCN 49 >XP_007037997.2 PREDICTED: mediator of RNA polymerase II transcription subunit 30 isoform X2 [Theobroma cacao] Length = 167 Score = 52.4 bits (124), Expect = 4e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EG KHLE++IEA+FQIL+SMNDELCN Sbjct: 21 ELAAEGLKHLEETIEAAFQILSSMNDELCN 50 >XP_002511168.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 isoform X1 [Ricinus communis] XP_015580971.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 isoform X1 [Ricinus communis] XP_015580973.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 isoform X1 [Ricinus communis] XP_015580978.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 isoform X1 [Ricinus communis] EEF51770.1 conserved hypothetical protein [Ricinus communis] Length = 196 Score = 52.8 bits (125), Expect = 4e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EGQKHLE++I+A++QIL+SMNDELCN Sbjct: 17 ELAMEGQKHLEETIQAAYQILSSMNDELCN 46 >XP_012090682.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 [Jatropha curcas] XP_012090683.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 [Jatropha curcas] KDP22607.1 hypothetical protein JCGZ_26438 [Jatropha curcas] Length = 191 Score = 52.4 bits (124), Expect = 6e-06 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EGQKHLE++I+A++QIL+SMNDELCN Sbjct: 17 ELALEGQKHLEETIQAAYQILSSMNDELCN 46 >XP_007037996.2 PREDICTED: mediator of RNA polymerase II transcription subunit 30 isoform X1 [Theobroma cacao] Length = 198 Score = 52.4 bits (124), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EG KHLE++IEA+FQIL+SMNDELCN Sbjct: 21 ELAAEGLKHLEETIEAAFQILSSMNDELCN 50 >XP_017604873.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 [Gossypium arboreum] Length = 198 Score = 52.4 bits (124), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EG KHLE++IEA+FQIL+SMNDELCN Sbjct: 23 ELASEGLKHLEETIEAAFQILSSMNDELCN 52 >XP_012467932.1 PREDICTED: mediator of RNA polymerase II transcription subunit 30 [Gossypium raimondii] KJB07979.1 hypothetical protein B456_001G058300 [Gossypium raimondii] KJB07980.1 hypothetical protein B456_001G058300 [Gossypium raimondii] KJB07981.1 hypothetical protein B456_001G058300 [Gossypium raimondii] KJB07982.1 hypothetical protein B456_001G058300 [Gossypium raimondii] Length = 198 Score = 52.4 bits (124), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EG KHLE++IEA+FQIL+SMNDELCN Sbjct: 23 ELASEGLKHLEETIEAAFQILSSMNDELCN 52 >EOY22497.1 Uncharacterized protein TCM_014655 isoform 1 [Theobroma cacao] Length = 198 Score = 52.4 bits (124), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 76 ELAREGQKHLEKSIEASFQILTSMNDELCN 165 ELA EG KHLE++IEA+FQIL+SMNDELCN Sbjct: 21 ELAAEGLKHLEETIEAAFQILSSMNDELCN 50