BLASTX nr result
ID: Phellodendron21_contig00035762
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00035762 (496 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007414408.1 hypothetical protein MELLADRAFT_110181 [Melampsor... 59 2e-07 >XP_007414408.1 hypothetical protein MELLADRAFT_110181 [Melampsora larici-populina 98AG31] EGG02423.1 hypothetical protein MELLADRAFT_110181 [Melampsora larici-populina 98AG31] Length = 270 Score = 59.3 bits (142), Expect = 2e-07 Identities = 31/59 (52%), Positives = 37/59 (62%) Frame = +1 Query: 10 HDRQIQFRSIAGALSGFTLALGASVLYRLRPMCSPRRXXXXXXXXXXXXXXEDVKDLLA 186 H+ Q+ R IAG +SGF LALGAS LYRLRP+ SPRR ED+KD+LA Sbjct: 105 HEDQLHCRFIAGGISGFILALGASSLYRLRPIYSPRRLMLGGLVGMLAGGAEDLKDILA 163